1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. PIN1 Protein, Human (His)

PIN1 Protein, Human (His)

Cat. No.: HY-P76547
Handling Instructions

The PIN1 protein is a peptidyl-prolyl cis/trans isomerase that complexly regulates multiple cellular processes by binding and isomerizing phosphorylated Ser/Thr-Pro motifs. This molecular switch induces conformational changes in phosphorylated proteins that affect mitosis, kinase activity, oncogene transactivation, centrosome amplification, and cell transformation. PIN1 Protein, Human (His) is the recombinant human-derived PIN1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PIN1 Protein, Human (His) is 163 a.a., with molecular weight of ~19 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
5 μg $35 Ask For Quote & Lead Time
10 μg $60 Ask For Quote & Lead Time
50 μg $165 Ask For Quote & Lead Time
100 μg $280 Ask For Quote & Lead Time
500 μg $780 Ask For Quote & Lead Time
1 mg $1250 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PIN1 protein is a peptidyl-prolyl cis/trans isomerase that complexly regulates multiple cellular processes by binding and isomerizing phosphorylated Ser/Thr-Pro motifs. This molecular switch induces conformational changes in phosphorylated proteins that affect mitosis, kinase activity, oncogene transactivation, centrosome amplification, and cell transformation. PIN1 Protein, Human (His) is the recombinant human-derived PIN1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PIN1 Protein, Human (His) is 163 a.a., with molecular weight of ~19 kDa.

Background

PIN1 Protein, a peptidyl-prolyl cis/trans isomerase (PPIase), intricately participates in multiple cellular processes by binding to and isomerizing specific phosphorylated Ser/Thr-Pro (pSer/Thr-Pro) motifs. This molecular switch induces conformational changes in phosphorylated proteins, influencing diverse cellular pathways. With a preference for acidic residues N-terminally to the proline bond, PIN1 regulates mitosis by interacting with NIMA, attenuating its mitosis-promoting activity, and down-regulating the kinase activity of BTK. It transactivates oncogenes, induces centrosome amplification, chromosome instability, and cell transformation. Moreover, PIN1 is crucial for the dephosphorylation and recycling of RAF1, binding and targeting PML and BCL6 for degradation, and acting as a regulator of the JNK cascade by disrupting FBXW7 dimerization. PIN1's involvement extends to DNA repair processes, where it influences the balance between error-prone non-homologous end joining (NHEJ) and error-free homologous recombination (HR). During IL33-induced lung inflammation, PIN1 catalyzes cis-trans isomerization of phosphorylated IRAK3/IRAK-M, contributing to IRAK3 stabilization, nuclear translocation, and the expression of pro-inflammatory genes in dendritic cells.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q13526 (M1-E163)

Gene ID
Molecular Construction
N-term
6*His
PIN1 (M1-E163)
Accession # Q13526
C-term
Synonyms
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1; Rotamase Pin1; PIN1
AA Sequence

MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Molecular Weight

Approximately19 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PIN1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PIN1 Protein, Human (His)
Cat. No.:
HY-P76547
Quantity:
MCE Japan Authorized Agent: