ITIH5 Protein, Human (HEK293, His-hFc)

The ITIH5 protein was identified as a potential tumor suppressor, indicating its critical role in controlling tumorigenesis. As a tumor suppressor, ITIH5 is expected to counteract uncontrolled cell growth and inhibit or regulate key pathways in tumor development. ITIH5 Protein, Human (HEK293, His-hFc) is the recombinant human-derived ITIH5 protein, expressed by HEK293 , with C-hFc labeled tag.

ITIH5 Protein emerges as a potential tumor suppressor, suggesting a crucial role in regulating tumorigenesis. Its designation as a tumor suppressor implies a capacity to counteract the uncontrolled cellular growth characteristic of cancer cells. By inhibiting or modulating key pathways involved in tumor development, ITIH5 may contribute to the maintenance of normal cellular function and prevention of malignant transformation. The characterization of ITIH5 as a putative tumor suppressor underscores its significance in the intricate network of cellular regulatory mechanisms, warranting further investigation into its specific mechanisms of action and potential therapeutic implications in cancer management.

Human

HEK293

C-hFc

Q86UX2 (V35-E161)

80760

VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Approximately 50 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.