GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc)

The GDF-8 protein, also known as myostatin, negatively regulates skeletal muscle growth.It acts as a disulfide-linked homodimer and inhibits its activity by interacting with WFIKKN2.Additionally, it interacts with FSTL3. GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc) is the recombinant mouse-derived GDF-8 protein, expressed by HEK293 , with N-hFc labeled tag.

The GDF-8 protein, also known as myostatin, acts specifically as a negative regulator of skeletal muscle growth. It functions as a homodimer that is disulfide-linked. Additionally, it interacts with WFIKKN2, leading to the inhibition of its activity. Furthermore, it has been found to interact with FSTL3.

Determined by its ability to inhibit the proliferation of MPC-11 cells. The ED₅₀ for this effect is 19.8 ng/mL, corresponding to a specific activity is 5.05×10⁴ U/mg.

Rat; Mouse; Human

HEK293

N-hFc

O08689 (D268-S376)

17700  [NCBI]

DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Approximately 40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping with dry ice.