1. MAPK/ERK Pathway Stem Cell/Wnt
  2. ERK
  3. TAT-DEF-Elk-1 TFA

TAT-DEF-Elk-1 TFA (TDE TFA) is a cell-penetrating peptide inhibitor of?Elk-1,?mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 TFA blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 TFA is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

TAT-DEF-Elk-1 TFA Chemical Structure

TAT-DEF-Elk-1 TFA Chemical Structure

Size Price Stock
1 mg Ask For Quote & Lead Time
5 mg Ask For Quote & Lead Time
10 mg Ask For Quote & Lead Time

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of TAT-DEF-Elk-1 TFA:

Top Publications Citing Use of Products

2 Publications Citing Use of MCE TAT-DEF-Elk-1 TFA

View All ERK Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

TAT-DEF-Elk-1 TFA (TDE TFA) is a cell-penetrating peptide inhibitor of?Elk-1,?mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 TFA blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 TFA is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity[1].

IC50 & Target

IC50: Elk-1[1]

In Vitro

Elk-1 phosphorylation on Ser383/389 has a dual function and triggers both Elk-1 nuclear translocation and SRE-dependent gene expression[1].
TAT-DEF-Elk-1 TFA (5 μM; 1 hour) specifically inhibits glutamate-induced elk-1 activation and does not interfer with ERK, MSK-1, or CREB phosphorylation[1].
TAT-DEF-Elk-1 TFA (5-10 μM; 2 hour) treatment shows a significant inhibition of c-Fos, Zif268 and JunB, but has no effects on c-Jun expression[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis[2]

Cell Line: Neurons
Concentration: 5 μM; 10 μM
Incubation Time: 1 hour
Result: Decreased elk-1 expression and had no effects on ERK, MSK-1, or CREB phosphorylation.

RT-PCR[2]

Cell Line: Primary striatal neurons
Concentration: 5 μM
Incubation Time: 2 hour
Result: Decreased c-Fos, Zif268 and JunB mRNA level but did not effect c-Jun.
In Vivo

TAT-DEF-Elk-1 TFA (intraperitoneal?injection; 1mg/kg; daily; 14 days) reflects antidepressant efficacy in mice, it decreases immobility similar to the reference antidepressants fluoxetine and desipramine (DMI)[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: C57Bl6 mice (3-6 months old males) are subjected to social defeat stress[2]
Dosage: 1 mg/kg
Administration: Intraperitoneal injection; daily; 14 days
Result: Reversed social-defeat induced decrease of hippocampal Bdnf expression by repeated TDE administration.
Molecular Weight

3675.09

Formula

C157H260N57F3O42

Appearance

Solid

Color

White to off-white

Sequence

Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Ser-Pro-Ala-Lys-Leu-Ser-Phe-Gln-Phe-Pro-Ser-Ser-Gly-Ser-Ala-Gln-Val-His-Ile

Sequence Shortening

GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TAT-DEF-Elk-1 TFA
Cat. No.:
HY-P2262A
Quantity:
MCE Japan Authorized Agent: