AADAC Protein, Human (His-SUMO)

AADAC, Human (His-SUMO) is an esterase functioning at the endoplasmic reticulum which involved in the hydrolysis of various drugs. AADAC, Human overexpression alters multiple vascular smooth muscle cells properties and decreases murine cardiovascular disease.

Arylacetamide deacetylase (AADAC) is the major enzyme responsible for the hydrolysis of various clinical drugs, such as flutamide, phenacetin, rifamycins, indiplon, prasugrel, and ketoconazole. AADAC is expressed in the human liver and gastrointestinal tract. AADAC is conserved in animal species, including mice, rats, dogs, and monkeys, although mice and rats have multiple Ces1 and Ces2 isoforms. It has been reported that the expression level of dog CES1 and CES2 in the intestine is much lower than that in the liver. AADAC overexpression alters multiple vascular smooth muscle cells properties and decreases murine cardiovascular disease^[1][2].

Measured by its ability to hydrolyze p-nitrophenylacetate. The specific activity is 886.313 pmol/min/µg, as measured under the described conditions.

Human

E. coli

N-10*His;N-SUMO

P22760 (P24-L399)

13  [NCBI]

PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL

Approximately 63.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Yoshida T, et, al. Difference in substrate specificity of carboxylesterase and arylacetamide deacetylase between dogs and humans. Eur J Pharm Sci. 2018 Jan 1;111:167-176.  [Content Brief]

  [2]. Misra A, et, al. Translational Research in Culture: AADAC, Diabetes, and Cardiovascular Disease. Cell Stem Cell. 2020 Jul 2;27(1):6-7.  [Content Brief]