Animal-Free IFN-lambda 1/IL-29 Protein, Human (His)

IFN-lambda 1/IL-29 protein is a multifaceted cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a crucial role in antiviral host defense, especially in epithelial tissues. Animal-Free IFN-lambda 1/IL-29 Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 1/IL-29 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IFN-lambda 1/IL-29 Protein, Human (His) is 178 a.a., with molecular weight of ~20.70 kDa.

IFN-lambda 1/IL-29 Protein, a multifaceted cytokine, exhibits antiviral, antitumor, and immunomodulatory activities. It plays a crucial role in antiviral host defense, particularly in epithelial tissues. Functioning as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, receptor engagement triggers the activation of the JAK/STAT signaling pathway, leading to the expression of IFN-stimulated genes (ISG) that mediate the antiviral state. Notably, its receptor distribution is limited, predominantly active in epithelial cells due to the epithelial cell-specific expression of its receptor IFNLR1. This cell type-selective action contributes to its targeted efficacy. Additionally, IFN-lambda 1/IL-29 exerts an immunomodulatory effect by up-regulating MHC class I antigen expression, further enhancing its role in immune responses.

Measure by its ability to induce IL-8 secretion in HuH7 cells. The ED₅₀ for this effect is <6 ng/mL.

Human

E. coli

C-His

Q8IU54 (P23-T200)

282618  [NCBI]

MPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Approximately 20.70 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.