1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interferon & Receptors
  4. IFN-lambda
  5. IFN-lambda 1/IL-29
  6. Animal-Free IFN-lambda 1/IL-29 Protein, Human (His)

Animal-Free IFN-lambda 1/IL-29 Protein, Human (His)

Cat. No.: HY-P700121AF
SDS COA Handling Instructions Technical Support

IFN-lambda 1/IL-29 protein is a multifaceted cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a crucial role in antiviral host defense, especially in epithelial tissues. Animal-Free IFN-lambda 1/IL-29 Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 1/IL-29 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IFN-lambda 1/IL-29 Protein, Human (His) is 178 a.a., with molecular weight of ~20.70 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-lambda 1/IL-29 protein is a multifaceted cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a crucial role in antiviral host defense, especially in epithelial tissues. Animal-Free IFN-lambda 1/IL-29 Protein, Human (His) is the recombinant human-derived animal-FreeIFN-lambda 1/IL-29 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IFN-lambda 1/IL-29 Protein, Human (His) is 178 a.a., with molecular weight of ~20.70 kDa.

Background

IFN-lambda 1/IL-29 Protein, a multifaceted cytokine, exhibits antiviral, antitumor, and immunomodulatory activities. It plays a crucial role in antiviral host defense, particularly in epithelial tissues. Functioning as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, receptor engagement triggers the activation of the JAK/STAT signaling pathway, leading to the expression of IFN-stimulated genes (ISG) that mediate the antiviral state. Notably, its receptor distribution is limited, predominantly active in epithelial cells due to the epithelial cell-specific expression of its receptor IFNLR1. This cell type-selective action contributes to its targeted efficacy. Additionally, IFN-lambda 1/IL-29 exerts an immunomodulatory effect by up-regulating MHC class I antigen expression, further enhancing its role in immune responses.

Biological Activity

Measure by its ability to induce IL-8 secretion in HuH7 cells. The ED50 for this effect is <6 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q8IU54 (P23-T200)

Gene ID
Molecular Construction
N-term
IFN-λ1 (P23-T200)
Accession # Q8IU54
His
C-term
Synonyms
rHuIFN-λ1/IL-29; IL-29; IFN-lambda-1; Cytokine Zcyto21; Interleukin-29
AA Sequence

MPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Molecular Weight

Approximately 20.70 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IFN-lambda 1/IL-29 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IFN-lambda 1/IL-29 Protein, Human (His)
Cat. No.:
HY-P700121AF
Quantity:
MCE Japan Authorized Agent: