GDF-11/BMP-11 Protein, Human (HEK293, solution)

The GDF-11/BMP-11 protein is a secreted signaling protein that globally regulates anterior/posterior axis patterning during development and plays a key role in mesoderm and neural tissue patterning. GDF-11/BMP-11 is critical for vertebral and orofacial development and signals through type 2 activin receptors (ACVR2A and ACVR2B) and type 1 activin receptors (ACVR1B, ACVR1C and TGFBR1), leading to SMAD2 and SMAD3 phosphorylation. GDF-11/BMP-11 Protein, Human (HEK293, solution) is the recombinant human-derived GDF-11/BMP-11 protein, expressed by HEK293 , with tag free. The total length of GDF-11/BMP-11 Protein, Human (HEK293, solution) is 109 a.a., with molecular weight of ~14.0 kDa.

GDF-11/BMP-11 is a secreted signaling protein with a global regulatory impact on anterior/posterior axial patterning during development and is implicated in critical roles in mesodermal and neural tissue patterning. Essential for proper vertebral and orofacial development, GDF-11/BMP-11 transmits signals through activin receptors type-2 (ACVR2A and ACVR2B) and activin receptors type-1 (ACVR1B, ACVR1C, and TGFBR1), leading to the phosphorylation of SMAD2 and SMAD3. The protein forms homodimers through disulfide linkages and interacts directly with ACVR2A, ACVR2B, ACVR1B, TGFBR1, and ACVR1C, the latter in an ACVR2B-dependent manner. Additionally, GDF-11/BMP-11 engages with FST isoform 2/FS-288, highlighting its intricate interactions with key receptors in the signaling pathway.

GDF-11/BMP-11 (5, 10, 20, and 40 ng/mL; 7 d) maintains the colony and cellular morphology of undifferentiated human embryonic stem cells (hESC), maintains POU5f1, NANOG, TRA-1-60, and SSEA4 expression, and displays increased SMAD2/3 phosphorylation in serum-free medium at 20 ng/mL concentration^[4].
GDF-11/BMP-11 (50-400 ng/mL; 2 d) induces browning of 3T3-L1 adipocytes via coordination of multiple signalling pathways, including mTORC1-COX2 and p38MAPK-PGC-1α as non-canonical pathways, as well as Smad1/5/8 as a canonical pathway^[5].

Human

HEK293

Tag Free

O95390 (N299-S407)

10220  [NCBI]

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 50% glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.