Search Result

Results for "

destruction

" in MedChemExpress (MCE) Product Catalog:

By Targets:	ADAMTS (1) Adrenergic Receptor (1) Apoptosis (3) Bacterial (4) Biochemical Assay Reagents (1) c-Fms (2) c-Kit (1) Caspase (1) CCR (2) CD47 (1) Dipeptidyl Peptidase (1) Discoidin Domain Receptor (1) DNA Alkylator/Crosslinker (1) E3 Ligase Ligand-Linker Conjugates (1) EGFR (1) ERK (1) Ferroptosis (1) FGFR (1) Fungal (3) Glucocorticoid Receptor (1) Glutathione Peroxidase (1) GnRH Receptor (1) Interleukin Related (1) Isotope-Labeled Compounds (1) MEK (1) NF-κB (2) NO Synthase (1) Parasite (1) PDGFR (1) Raf (1) RANKL/RANK (2) Reactive Oxygen Species (4) TGF-β Receptor (1) TNF Receptor (5) VEGFR (1)
By Research Areas:	Cancer (20) Endocrinology (3) Infection (7) Inflammation/Immunology (16) Metabolic Disease (4)

By Targets:

ADAMTS (1)

Adrenergic Receptor (1)

Apoptosis (3)

Bacterial (4)

Biochemical Assay Reagents (1)

c-Fms (2)

c-Kit (1)

Caspase (1)

CCR (2)

CD47 (1)

Dipeptidyl Peptidase (1)

Discoidin Domain Receptor (1)

DNA Alkylator/Crosslinker (1)

E3 Ligase Ligand-Linker Conjugates (1)

EGFR (1)

ERK (1)

Ferroptosis (1)

FGFR (1)

Fungal (3)

Glucocorticoid Receptor (1)

Glutathione Peroxidase (1)

GnRH Receptor (1)

Interleukin Related (1)

Isotope-Labeled Compounds (1)

MEK (1)

NF-κB (2)

NO Synthase (1)

Parasite (1)

PDGFR (1)

Raf (1)

RANKL/RANK (2)

Reactive Oxygen Species (4)

TGF-β Receptor (1)

TNF Receptor (5)

VEGFR (1)

By Research Areas:

Cancer (20)

Endocrinology (3)

Infection (7)

Inflammation/Immunology (16)

Metabolic Disease (4)

Inhibitors & Agonists

Screening Libraries

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

Natural
Products

Isotope-Labeled Compounds

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-19364

Ferroquine 2 Publications Verification Ferrochloroquine; SSR97193	Parasite	Infection
Ferroquine (Ferrochloroquine), a ferrocenyl analogue of Chloroquine, is an antimalarial agent. Ferroquine shows parasiticidal effect on *Plasmodium* by inducing oxidative stress and the subsequent destruction of the membrane .

HY-17644

Redaporfin LUZ11; F2BMet	Reactive Oxygen Species	Cancer
Redaporfin (LUZ11) acts as a potent photosensitizer. Redaporfin causes direct antineoplastic effects as well as indirect immune-dependent destruction of malignant lesions .

HY-128380

Dibenamine hydrochloride N-(2-Chloroethyl)dibenzylamine hydrochloride	Adrenergic Receptor	Metabolic Disease
Dibenamine hydrochloride is a competitive and irreversible adrenergic blocking agent and is known to modify the pharmacological effects of epinephrine. Dibenamine hydrochloride cause a significant increase in the rate of destruction of I-epinephrine in the mouse .

HY-108004

Decamethoxine Septefril; Decametoxin	Bacterial Fungal	Infection
Decamethoxine (Septefril) is a cationic gemini surfactant. Decamethoxine exhibits strong bactericidal and fungicidal effects. Decamethoxine modifies the permeability of the microbial cell membrane, resulting in the destruction and death of diverse microorganisms .

HY-128075

Acifluorfen	Others	Cancer
Acifluorfen, a protoporphyrinogen oxidase (PROTOX) inhibitor herbicide, promotes the accumulation of protoporphyrin IX (PPIX), and induces tumors in the rodent liver. Acifluorfen causes strong photooxidative destruction of pigments and lipids in sensitive plant species .

HY-156996

AGI-134	Others	Inflammation/Immunology Cancer
AGI-134 is a fully synthetic alpha-Gal glycolipid. AGI-134 invokes CD8+ T cell-mediated immunity. AGI-134 induces tumor cell destruction and phagocytosis .

HY-N9794

Isoboldine	Others	Inflammation/Immunology
Isoboldine is a pyridine alkaloid. Isoboldine effectively alleviates inflammation and joint destruction in collagen-induced arthritis in mice .

HY-N12740

Napyradiomycin B4	MEK ERK	Others
Napyradiomycin B4 is a Napyradiomycin derivative, which inhibits the RANKL-induced MEK-ERK signaling pathway. Napyradiomycin B4 attenuates osteoclastogenesis and prevents alveolar bone destruction in experimental periodontitis .

HY-P0009

Cetrorelix SB-75	GnRH Receptor	Endocrinology
Cetrorelix is a potent gonadotrophin-releasing hormone (GnRH) antagonist. Cetrorelix inhibits the endogenous luteinizing hormone surge during ovarian stimulation. Cetrorelix reduces cyclophosphamide induced ovarian follicular destruction in mice .

HY-118985

Acifluorfen sodium	Others	Cancer
Acifluorfen sodium, a protoporphyrinogen oxidase (PROTOX) inhibitor herbicide, promotes the accumulation of protoporphyrin IX (PPIX), and induces tumors in the rodent liver. Acifluorfen sodium causes strong photooxidative destruction of pigments and lipids in sensitive plant species .

HY-114996

ADAMTS-5 Inhibitor 3 Publications Verification	ADAMTS	Inflammation/Immunology
ADAMTS-5 Inhibitor is a potent ADAMTS-5 (aggrecanase-2) inhibitor, with an IC₅₀ of 1.1 µM. ADAMTS-5 Inhibitor shows >40-fold functional selectivity over ADAMTS-4 (aggrecanase-1) .

HY-106431

Olpadronic acid Olpadronate; OLP	Others	Metabolic Disease Cancer
Olpadronic acid (Olpadronate) is an orally active amino-bisphosphonate and inhibits bone resorption. Olpadronic acid also prevents bone destruction and tumor growth in the skeletal prostate cancer mouse model. Olpadronic acid can be used for research of osteoporosis, malignancies and rheumatoid arthritis .

HY-24574

(E)-5-Octadecene (E)-Octadec-5-ene	Others	Endocrinology
(E)-5-Octadecene ((E)-Octadec-5-ene) is a sex pheromone or a related chemical component. (E)-5-Octadecene has effect on destruction of sexual attraction of female moth of rice borers moth (Chilo suppressalis Walker) .

HY-131890

VH032 amide-PEG1-acid	DNA Alkylator/Crosslinker E3 Ligase Ligand-Linker Conjugates	Cancer
VH032 amide-PEG1-acid (linker 10) is a VHL-1 alkyl linker that can be used to bind CDK4/6 ligands (PI) and degradation/destruction tags (EL) (e.g.,E3 ligase ligands) .

HY-136990

GLPG0259	Others	Cancer
GLPG0259 is a ATP-competitive inhibitor of MAPK-activated protein kinase 5 (MK5) with oral activity. GLPG0259 reduces inflammation and bone destruction in a mouse model of collagen-induced arthritis. GLPG0259 also inhibited the metastasis of prostate cancer (PCa) cells .

HY-N0070

Solasonine 2 Publications Verification	Ferroptosis Glutathione Peroxidase Reactive Oxygen Species	Cancer
Solasonine is a ferroptosis inducer which can be isolated from Solanum melongena that has anti-infection, anti-cancer, and neurogenesis promoting properties. Solasonine promotes ferroptosis of HCC cells via destruction of the glutathione redox system induced by inhibiting GPX4, and can be used for cancer research .

HY-128075R

Acifluorfen (Standard)	Others	Cancer
Acifluorfen (Standard) is the analytical standard of Acifluorfen. This product is intended for research and analytical applications. Acifluorfen, a protoporphyrinogen oxidase (PROTOX) inhibitor herbicide, promotes the accumulation of protoporphyrin IX (PPIX), and induces tumors in the rodent liver. Acifluorfen causes strong photooxidative destruction of pigments and lipids in sensitive plant species .

HY-B0636

Triamcinolone acetonide 4 Publications Verification	Glucocorticoid Receptor FGFR	Inflammation/Immunology Endocrinology Cancer
Triamcinolone acetonide inhibits basic fibroblast growth factor (bFGF) induced proliferation of retinal endothelial cells. Triamcinolone acetonide reduces chondrocyte viability and leads to cartilage destruction. Triamcinolone acetonide activates macrophage with anti-inflammatory characteristics. Triamcinolone acetonide can be used in the study of diseases such as atopic dermatitis .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-154993

Gamma-Glutamyl Transferase-IN-1	Fungal	Infection
Gamma-Glutamyl Transferase-IN-1 (compound 4de) is a β-carboline 1-hydrazide inhibitor with antifungal and antibacterial activities, targeting to glutamyltransferase. Gamma-Glutamyl Transferase-IN-1 acts function by resulting the accumulation of reactive oxygen species, destruction of cell membranes, and dysregulation of histone acetylation .

HY-154996

Gamma-Glutamyl Transferase-IN-2	Fungal	Infection
Gamma-Glutamyl Transferase-IN-2 (compound 4dq) is a β-carboline 1-hydrazide inhibitor with antifungal and antibacterial activities, targeting to glutamyltransferase. Gamma-Glutamyl Transferase-IN-2 acts function by resulting the accumulation of reactive oxygen species, destruction of cell membranes, and dysregulation of histone acetylation .

HY-W127809

Chlorin e4	Biochemical Assay Reagents	Others
Chlorin e4 is an organic compound belonging to the family of chlorins, which are macrocyclic compounds with a similar structure to porphyrins. It is commonly used to improve photodynamic therapy for cancer and other diseases. Chlorin e4 has multiple applications in medical research, including as a photosensitizer for localized tumor destruction. In addition, its antimicrobial properties and potential use in disinfection applications were investigated.

HY-146421

Anti-inflammatory agent 21	NO Synthase NF-κB Reactive Oxygen Species	Inflammation/Immunology
Anti-inflammatory agent 21 (compound 9o) is an orally active and low cytotoxic anti-inflammatory agent, with an IC₅₀ value of 0.76 μM for NO. Anti-inflammatory agent 21 acts via accumulation ROS and blocks the NF-κB/MAPK signaling pathway. Anti-inflammatory agent 21 can ameliorate cartilage destruction and inflammatory cell infiltration in arthritis rats model .

HY-P99259

Cabiralizumab FPA 008; Anti-Human CSF1R Recombinant Antibody	c-Fms	Inflammation/Immunology Cancer
Cabiralizumab (FPA 008) is an anti-CSF1R monoclonal antibody (MAb). Cabiralizumab enhances T cell infiltration and antitumor T cell immune responses. Cabiralizumab inhibits the activation of osteoclasts and blocks bone destruction, and can be used in the research of rheumatoid arthritis (RA). Cabiralizumab can combine with Nivolumab (HY-P9903) for lung cancer research .

HY-P2612

WP9QY	TNF Receptor	Others
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)

HY-N6973R

Boldine (Standard)	RANKL/RANK	Inflammation/Immunology
Boldine (Standard) is the analytical standard of Boldine. This product is intended for research and analytical applications. Boldine is an aporphine isoquinoline alkaloid extracted from the root of Litsea cubeba and also possesses these properties, including antioxidant, anti-inflammatory and cytoprotective effects. Boldine suppresses osteoclastogenesis, improves bone destruction by down-regulating the OPG/RANKL/RANK signal pathway and may be a potential therapeutic agent for rheumatoid arthritis .

HY-P2612A

WP9QY TFA	TNF Receptor	Others Cancer
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)

HY-P10438

Tat-braftide	Raf	Cancer
Tat-braftide is a peptide inhibitor designed to block the dimerization of BRAF, thereby inhibiting its kinase activity. The destruction of BRAF dimer by Tat-braftide makes BRAF protein more susceptible to proteasome degradation, directly inhibits the activity of BRAF kinase, and reduces the activation of MAPK signaling pathway. Tat-braftide can be used for the role of RAF kinase in MAPK signaling pathway and for the study of BRAF mutant cancers .

HY-P4191A

Met-RANTES (human) (acetate)	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-P99625

Frexalimab SAR441344; INX-021	TNF Receptor	Inflammation/Immunology
Frexalimab (SAR441344) is a second-generation monoclonal antibody targeting the CD40 ligand (CD40L) with a good safety profile. Frexalimab inhibits the binding between CD40 and CD40L to modulate immune response. Frexalimab is likely to help prevent the process of β-cell destruction. Frexalimab is proming for multiple sclerosis, lupus erythematosus, Sjögren’s syndrome and type I diabetes research .

HY-P10370

d-(KLAKLAK)2, Proapoptotic Peptide	Bacterial Apoptosis	Infection Cancer
d-(KLAKLAK)2, as an antibacterial and anti-tumor polypeptide, is a representative of the antimicrobial peptide group, and also has good anticancer properties. d-(KLAKLAK)2 is able to kill bacteria by damaging their cell membranes, causing cell contents to leak out. d-(KLAKLAK)2 can also inhibit tumor cell proliferation by causing mitochondrial swelling and mitochondrial membrane destruction, triggering apoptosis (programmed cell death) .

HY-10408

Ki20227 5 Publications Verification	c-Fms VEGFR c-Kit PDGFR	Inflammation/Immunology
Ki20227 is an orally active and highly selective c-Fms tyrosine kinase (CSF1R) inhibitor with IC₅₀s of 2 nM, 12 nM, 451 and 217 nM for CSF1R, VEGFR2 (vascular endothelial growth factor receptor-2), c-Kit (stem cell factor receptor) and PDGFRβ (platelet-derived growth factor receptor β). Ki20227 suppresses osteoclast differentiation and osteolytic bone destruction .

HY-N6973

Boldine 1 Publications Verification	RANKL/RANK Apoptosis	Inflammation/Immunology
Boldine is an apomorphine isoquinoline alkaloid extracted from the root of the pheasant pepper (Litsea cubeba). Boldine is an oral effective antioxidant, anti-inflammatory, antitumor agent, and can inhibit osteoclast formation. Boldine induces apoptosis of human bladder cancer cells by regulating ERK, AKT and GSK-3β. Boldine ameliorates bone destruction by down-regulating the OPG/RANKL/RANK signaling pathway. It can be used in rheumatoid arthritis research .

HY-P99111

Golimumab CNTO-148	TNF Receptor Apoptosis Interleukin Related Caspase	Inflammation/Immunology Cancer
Golimumab (CNTO-148) is a potent human IgG1 TNFα antagonist monoclonal antibody. Golimumab has anti-inflammation activitity and inhibits IL-6 and IL-1β production. Golimumab acts via targeting and neutralizing TNF to prevent inflammation and destruction of cartilage and bone. Golimumab has the anticancer activity and induces cell apoptosis. Golimumab can be used for rheumatoid arthritis, Crohn's disease and cancer research .

HY-105048A

Omiganan pentahydrochloride	Bacterial	Infection
Omiganan pentahydrochloride is a cationic peptide compound with a broad antibacterial profile. Omiganan pentahydrochloride is capable of inhibiting a variety of bacteria, including yeast, and is active against both gram-positive and gram-negative bacteria. Omiganan pentahydrochloride is able to interact with the bacterial cell membrane, causing the destruction of the cell membrane and the death of the bacteria. Omiganan pentahydrochloride can be used for the study of antimicrobial activity against pathogens commonly associated with catheter-associated infections, including strains with drug-resistant phenotypes .

HY-114169

WRG-28	Discoidin Domain Receptor	Inflammation/Immunology Cancer
WRG-28 is a selective, extracellularly acting DDR2 allosteric inhibitor, with an IC₅₀ of 230 nM. WRG-28 inhibits tumor invasion, migration and tumor-supporting effects of cancer-associated fibroblasts (CAFs). WRG-28 inhibits metastatic breast tumor cell colonization in the lungs. WRG-28 also shows good activity of relieving rheumatoid arthritis in CAIA model of mice .

HY-124958

NDMC101	NF-κB Dipeptidyl Peptidase	Metabolic Disease Inflammation/Immunology
NDMC101 is a potent osteoclastogenesis inhibitor and inhibits osteoclast differentiation via down-regulation of NFATc1-modulated gene expression. NDMC101 is similar to the DPP4 substrate and is a significant inhibitor of early T-cell activation via DPP4 inhibition. NDMC101can be used for study of bone disorders, such as rheumatoid arthritis, and synovial inflammation et al .

HY-114169S

WRG-28-d5	Isotope-Labeled Compounds	Cancer
WRG-28-d5 is the deuterium labeled WRG-28(HY-114169).WRG-28 is a selective, extracellularly acting DDR2 allosteric inhibitor, with an IC₅₀ of 230 nM. WRG-28 inhibits tumor invasion, migration and tumor-supporting effects of cancer-associated fibroblasts (CAFs). WRG-28 inhibits metastatic

HY-P99605

Cinrebafusp alfa PRS 343	EGFR TNF Receptor	Cancer
Cinrebafusp alfa (PRS 343) is a high affinity CD137/HER2 bispecfic anticalin-based drug. Cinrebafusp alfa binds to recombinant human HER2 (K_d=0.3 nM) and human monomeric CD137 (4-1BB; K_d=5 nM). Cinrebafusp alfa facilitates T-cell costimulation by tumor-localized, HER2-dependent 4-1BB clustering and activation, further enhancing T-cell receptor-mediated activity and leading to tumor destruction. Cinrebafusp alfa has the potential for HER2+ solid tumors research .

HY-P10388

TAX2 peptide	CD47 TGF-β Receptor	Cancer
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .

HY-162818

Antibacterial agent 237	Bacterial Reactive Oxygen Species	Infection
Antibacterial agent 237 (compound Ru-8) is a bacteriostatic agent for Staphylococcus aureus, with MIC of 0.78-1.56 μg/mL. Antibacterial agent 237 destroys bacterial cell membranes, changes their permeability, and induces bacteria to produce Reactive Oxygen Species, leading to bacterial death without causing drug resistance. Antibacterial agent 237 has low hemolytic toxicity to rabbit red blood cells and Raw 264.7 cells, and has significant antibacterial effects against Staphylococcus aureus in mouse skin wound infection models and Bacillus major larvae infection models .

HY-W129441

N-Acetyl-4-S-cysteaminylphenol N-Ac-4-S-CAP	Others	Others
N-Acetyl-4-S-mercaptoaminophenol (N-Ac-4-S-CAP) is a compound that is selectively cytotoxic to melanocytes of black mouse hair follicles. It can cause 98% depigmentation of black mouse hair follicles. N-Ac-4-S-CAP can produce visible changes in hair follicle melanocytes 4 hours after intraperitoneal injection, including aggregation of melanin granules and nuclear condensation. Electron microscopy observations showed that it caused progressive destruction of melanocytes, including swelling of membranous organelles, nuclear condensation, and cytoplasmic vacuolation, ultimately leading to complete cell necrosis. N-Ac-4-S-CAP has a specific cytotoxic effect on melanocytes that actively produce eumelanin, but may not affect precursor or dormant melanocytes. These properties suggest that N-Ac-4-S-CAP may have potential application value in the treatment of melanoma or skin whitening.

Cat. No.	Product Name

HY-L185

Anti-Fibrosis Compound Library	1,659 compounds
Fibrosis is a kind of repair response to long-term tissue damage, which is mainly manifested by excessive deposition of extracellular matrix (ECM) and scar formation. Myofibroblasts are the main generating cells of extracellular matrix, and their activation process is related to various pathological mechanisms including Oxidative stress, chronic inflammation and cytokine secretion. Fibrosis can occur in many organs, such as kidneys, liver, heart, lungs, etc. Continuous fibrosis can lead to the destruction of the normal structure of tissues and organs, and if not controlled in time, may cause organ failure or even life-threatening. MCE contains 1,659 compounds targeting ant-fibrosis targets such as TGF-β, PI3K, Wnt, MMP, etc. These compounds have clear or potential anti-fibrosis activity and can be used for mechanism research and drug screening of fibrosis diseases.

Anti-Fibrosis Compound Library

1,659 compounds

Fibrosis is a kind of repair response to long-term tissue damage, which is mainly manifested by excessive deposition of extracellular matrix (ECM) and scar formation. Myofibroblasts are the main generating cells of extracellular matrix, and their activation process is related to various pathological mechanisms including Oxidative stress, chronic inflammation and cytokine secretion. Fibrosis can occur in many organs, such as kidneys, liver, heart, lungs, etc. Continuous fibrosis can lead to the destruction of the normal structure of tissues and organs, and if not controlled in time, may cause organ failure or even life-threatening.

MCE contains 1,659 compounds targeting ant-fibrosis targets such as TGF-β, PI3K, Wnt, MMP, etc. These compounds have clear or potential anti-fibrosis activity and can be used for mechanism research and drug screening of fibrosis diseases.

HY-L125

Anti-Pulmonary Fibrosis Compound Library	1,831 compounds
Pulmonary fibrosis (PF), also known as diffuse interstitial pulmonary fibrosis, is a very common end-stage manifestation of several diseases, including idiopathic pulmonary fibrosis (IPF), pulmonary hypertension, and scleroderma, characterised by excessive matrix deposition and destruction of the lung architecture, finally leading to respiratory insufficiency. PF has become a global disease with significantly increased incidence rate, and the most common form of pulmonary fibrosis is idiopathic pulmonary fibrosis (IPF). Lung fibrosis is a complex disease, a multitude of signal factors and signaling pathways is disrupted in this complex disease, such as TGF-β, Wnt, VEGF and PI3K–Akt. MCE offers a unique collection of 1,831 compounds with identified and potential anti-pulmonary fibrosis activity. MCE Anti-Pulmonary Fibrosis Compound Library is a useful tool for anti-pulmonary fibrosis drugs screening and other related research.

Anti-Pulmonary Fibrosis Compound Library

1,831 compounds

Pulmonary fibrosis (PF), also known as diffuse interstitial pulmonary fibrosis, is a very common end-stage manifestation of several diseases, including idiopathic pulmonary fibrosis (IPF), pulmonary hypertension, and scleroderma, characterised by excessive matrix deposition and destruction of the lung architecture, finally leading to respiratory insufficiency. PF has become a global disease with significantly increased incidence rate, and the most common form of pulmonary fibrosis is idiopathic pulmonary fibrosis (IPF).

Lung fibrosis is a complex disease, a multitude of signal factors and signaling pathways is disrupted in this complex disease, such as TGF-β, Wnt, VEGF and PI3K–Akt. MCE offers a unique collection of 1,831 compounds with identified and potential anti-pulmonary fibrosis activity. MCE Anti-Pulmonary Fibrosis Compound Library is a useful tool for anti-pulmonary fibrosis drugs screening and other related research.

HY-L040

Anti-diabetic Compound Library	793 compounds
Diabetes mellitus, usually called diabetes, is a group of metabolic disorders characterized by a high blood sugar level over a prolonged period of time. The most common types are Type I and Type II. Type I diabetes (T1D), also called juvenile onset diabetes mellitus or insulin-dependent diabetes mellitus, is characterized by destruction of the β-cells of the pancreas and insulin is not produced, whereas type II diabetes (T2D), also called non-insulin-dependent diabetes mellitus, is characterized by a progressive impairment of insulin secretion and relative decreased sensitivity of target tissues to the action of this hormone. Type 2 diabetes accounts for the vast majority of all diabetes mellitus. Diabetes of all types can lead to complications in many parts of the body and can increase the overall risk of dying prematurely. Possible complications include kidney failure, leg amputation, vision loss and nerve damage. The pathogenesis of diabetes is complicated, and development of the safe and effective drugs against diabetes is full of challenge. Increasing studies have confirmed that the pathogenesis of diabetes is related to various signaling pathways, such as insulin signaling pathway, AMPK pathway, PPAR regulation and chromatin modification pathways. These signaling pathways have thus become the major source of the promising novel drug targets to treat metabolic diseases and diabetes. MCE Anti-diabetic Compound Library owns a unique collection of 793 compounds, which mainly target SGLT, PPAR, DPP-4, AMPK, Dipeptidyl Peptidase, Glucagon Receptor, etc. This library is a useful tool for discovery anti-diabetes drugs.

Anti-diabetic Compound Library

793 compounds

Diabetes mellitus, usually called diabetes, is a group of metabolic disorders characterized by a high blood sugar level over a prolonged period of time. The most common types are Type I and Type II. Type I diabetes (T1D), also called juvenile onset diabetes mellitus or insulin-dependent diabetes mellitus, is characterized by destruction of the β-cells of the pancreas and insulin is not produced, whereas type II diabetes (T2D), also called non-insulin-dependent diabetes mellitus, is characterized by a progressive impairment of insulin secretion and relative decreased sensitivity of target tissues to the action of this hormone. Type 2 diabetes accounts for the vast majority of all diabetes mellitus. Diabetes of all types can lead to complications in many parts of the body and can increase the overall risk of dying prematurely. Possible complications include kidney failure, leg amputation, vision loss and nerve damage.

The pathogenesis of diabetes is complicated, and development of the safe and effective drugs against diabetes is full of challenge. Increasing studies have confirmed that the pathogenesis of diabetes is related to various signaling pathways, such as insulin signaling pathway, AMPK pathway, PPAR regulation and chromatin modification pathways. These signaling pathways have thus become the major source of the promising novel drug targets to treat metabolic diseases and diabetes.

MCE Anti-diabetic Compound Library owns a unique collection of 793 compounds, which mainly target SGLT, PPAR, DPP-4, AMPK, Dipeptidyl Peptidase, Glucagon Receptor, etc. This library is a useful tool for discovery anti-diabetes drugs.

Cat. No.	Product Name	Type

HY-W127809

Chlorin e4

Biochemical Assay Reagents

Chlorin e4 is an organic compound belonging to the family of chlorins, which are macrocyclic compounds with a similar structure to porphyrins. It is commonly used to improve photodynamic therapy for cancer and other diseases. Chlorin e4 has multiple applications in medical research, including as a photosensitizer for localized tumor destruction. In addition, its antimicrobial properties and potential use in disinfection applications were investigated.

Cat. No.	Product Name	Target	Research Area

HY-105063

DiaPep277	Peptides	Metabolic Disease Inflammation/Immunology
DiaPep277 is a 24 amino acid peptide derived from positions 437-460 in HSP60. DiaPep277 arrests the progression of β-cell destruction in NOD mice. DiaPep277 has an immune modulatory effect on diabetogenic T cells in animal models of diabetes .

HY-P2612A

WP9QY TFA	TNF Receptor	Others Cancer
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)

HY-P0009

Cetrorelix SB-75	GnRH Receptor	Endocrinology
Cetrorelix is a potent gonadotrophin-releasing hormone (GnRH) antagonist. Cetrorelix inhibits the endogenous luteinizing hormone surge during ovarian stimulation. Cetrorelix reduces cyclophosphamide induced ovarian follicular destruction in mice .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-P2612

WP9QY	TNF Receptor	Others
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)

HY-P10438

Tat-braftide	Raf	Cancer
Tat-braftide is a peptide inhibitor designed to block the dimerization of BRAF, thereby inhibiting its kinase activity. The destruction of BRAF dimer by Tat-braftide makes BRAF protein more susceptible to proteasome degradation, directly inhibits the activity of BRAF kinase, and reduces the activation of MAPK signaling pathway. Tat-braftide can be used for the role of RAF kinase in MAPK signaling pathway and for the study of BRAF mutant cancers .

HY-P4191A

Met-RANTES (human) (acetate)	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-P10370

d-(KLAKLAK)2, Proapoptotic Peptide	Bacterial Apoptosis	Infection Cancer
d-(KLAKLAK)2, as an antibacterial and anti-tumor polypeptide, is a representative of the antimicrobial peptide group, and also has good anticancer properties. d-(KLAKLAK)2 is able to kill bacteria by damaging their cell membranes, causing cell contents to leak out. d-(KLAKLAK)2 can also inhibit tumor cell proliferation by causing mitochondrial swelling and mitochondrial membrane destruction, triggering apoptosis (programmed cell death) .

HY-105048A

Omiganan pentahydrochloride	Bacterial	Infection
Omiganan pentahydrochloride is a cationic peptide compound with a broad antibacterial profile. Omiganan pentahydrochloride is capable of inhibiting a variety of bacteria, including yeast, and is active against both gram-positive and gram-negative bacteria. Omiganan pentahydrochloride is able to interact with the bacterial cell membrane, causing the destruction of the cell membrane and the death of the bacteria. Omiganan pentahydrochloride can be used for the study of antimicrobial activity against pathogens commonly associated with catheter-associated infections, including strains with drug-resistant phenotypes .

HY-P5488

BDC2.5 Mimotope 1040-63	Peptides	Others
BDC2.5 Mimotope 1040-63 is a biological active peptide. (The TCR transgenic model (BDC2.5) mimitope was used in type 1 diabetes (T1D) study. T1D is an autoimmune disease in which T cells mediate damage to pancreatic islet b cells. T1D is caused by autoreactive T cell destruction of insulin-producing cells. BDC2.5 mimotope was utilized to support the study on antigen presentation of antigenic peptides to islet autoantigen-specific T cells.)

HY-P10388

TAX2 peptide	CD47 TGF-β Receptor	Cancer
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .

Cat. No.	Product Name	Target	Research Area

HY-P99176

ATG-031 1 Publications Verification	Inhibitory Antibodies	Cancer
ATG-031 is a humanised anti-CD24 monoclonal antibody. ATG-031 effectively stimulates macrophage-mediated phagocytosis and induces cancer cell destruction by blocking the "don't eat me" signals that characterize the growth of many cancers. ATG-031 can be used in the study of haematological malignancies as well as solid tumours.

HY-P99259

Cabiralizumab FPA 008; Anti-Human CSF1R Recombinant Antibody	c-Fms	Inflammation/Immunology Cancer
Cabiralizumab (FPA 008) is an anti-CSF1R monoclonal antibody (MAb). Cabiralizumab enhances T cell infiltration and antitumor T cell immune responses. Cabiralizumab inhibits the activation of osteoclasts and blocks bone destruction, and can be used in the research of rheumatoid arthritis (RA). Cabiralizumab can combine with Nivolumab (HY-P9903) for lung cancer research .

HY-P99625

Frexalimab SAR441344; INX-021	TNF Receptor	Inflammation/Immunology
Frexalimab (SAR441344) is a second-generation monoclonal antibody targeting the CD40 ligand (CD40L) with a good safety profile. Frexalimab inhibits the binding between CD40 and CD40L to modulate immune response. Frexalimab is likely to help prevent the process of β-cell destruction. Frexalimab is proming for multiple sclerosis, lupus erythematosus, Sjögren’s syndrome and type I diabetes research .

HY-P99111

Golimumab CNTO-148	TNF Receptor Apoptosis Interleukin Related Caspase	Inflammation/Immunology Cancer
Golimumab (CNTO-148) is a potent human IgG1 TNFα antagonist monoclonal antibody. Golimumab has anti-inflammation activitity and inhibits IL-6 and IL-1β production. Golimumab acts via targeting and neutralizing TNF to prevent inflammation and destruction of cartilage and bone. Golimumab has the anticancer activity and induces cell apoptosis. Golimumab can be used for rheumatoid arthritis, Crohn's disease and cancer research .

HY-P99605

Cinrebafusp alfa PRS 343	EGFR TNF Receptor	Cancer
Cinrebafusp alfa (PRS 343) is a high affinity CD137/HER2 bispecfic anticalin-based drug. Cinrebafusp alfa binds to recombinant human HER2 (K_d=0.3 nM) and human monomeric CD137 (4-1BB; K_d=5 nM). Cinrebafusp alfa facilitates T-cell costimulation by tumor-localized, HER2-dependent 4-1BB clustering and activation, further enhancing T-cell receptor-mediated activity and leading to tumor destruction. Cinrebafusp alfa has the potential for HER2+ solid tumors research .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-N0070

Solasonine 2 Publications Verification	Alkaloids Piperidine Alkaloids Structural Classification Classification of Application Fields Source classification Solanum nigrum Linn. Solanaceae Plants Disease Research Fields Cancer	Ferroptosis Glutathione Peroxidase Reactive Oxygen Species
Solasonine is a ferroptosis inducer which can be isolated from Solanum melongena that has anti-infection, anti-cancer, and neurogenesis promoting properties. Solasonine promotes ferroptosis of HCC cells via destruction of the glutathione redox system induced by inhibiting GPX4, and can be used for cancer research .

HY-P99259

Cabiralizumab FPA 008; Anti-Human CSF1R Recombinant Antibody	Classification of Application Fields Disease Research Fields Cancer	c-Fms
Cabiralizumab (FPA 008) is an anti-CSF1R monoclonal antibody (MAb). Cabiralizumab enhances T cell infiltration and antitumor T cell immune responses. Cabiralizumab inhibits the activation of osteoclasts and blocks bone destruction, and can be used in the research of rheumatoid arthritis (RA). Cabiralizumab can combine with Nivolumab (HY-P9903) for lung cancer research .

HY-P2612A

WP9QY TFA	Classification of Application Fields Disease Research Fields Cancer	TNF Receptor
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)

HY-N6973

Boldine 1 Publications Verification	Alkaloids Structural Classification Classification of Application Fields Source classification Phenols Polyphenols Plants Lauraceae Isoquinoline Alkaloids Inflammation/Immunology Disease Research Fields Litsea cubeba (Lour.) Pers.	RANKL/RANK Apoptosis
Boldine is an apomorphine isoquinoline alkaloid extracted from the root of the pheasant pepper (Litsea cubeba). Boldine is an oral effective antioxidant, anti-inflammatory, antitumor agent, and can inhibit osteoclast formation. Boldine induces apoptosis of human bladder cancer cells by regulating ERK, AKT and GSK-3β. Boldine ameliorates bone destruction by down-regulating the OPG/RANKL/RANK signaling pathway. It can be used in rheumatoid arthritis research .

HY-P99605

Cinrebafusp alfa PRS 343	Classification of Application Fields Disease Research Fields Cancer	EGFR TNF Receptor
Cinrebafusp alfa (PRS 343) is a high affinity CD137/HER2 bispecfic anticalin-based drug. Cinrebafusp alfa binds to recombinant human HER2 (K_d=0.3 nM) and human monomeric CD137 (4-1BB; K_d=5 nM). Cinrebafusp alfa facilitates T-cell costimulation by tumor-localized, HER2-dependent 4-1BB clustering and activation, further enhancing T-cell receptor-mediated activity and leading to tumor destruction. Cinrebafusp alfa has the potential for HER2+ solid tumors research .

HY-N9794

Isoboldine	Structural Classification Alkaloids Piperidine Alkaloids Source classification Phenols Polyphenols Plants Lauraceae Lindera aggregata (Sims) Kosterm.	Others
Isoboldine is a pyridine alkaloid. Isoboldine effectively alleviates inflammation and joint destruction in collagen-induced arthritis in mice .

HY-N12740

Napyradiomycin B4	Structural Classification Natural Products Microorganisms Source classification	MEK ERK
Napyradiomycin B4 is a Napyradiomycin derivative, which inhibits the RANKL-induced MEK-ERK signaling pathway. Napyradiomycin B4 attenuates osteoclastogenesis and prevents alveolar bone destruction in experimental periodontitis .

HY-N6973R

Boldine (Standard)	Structural Classification Alkaloids Classification of Application Fields Source classification Phenols Plants Lauraceae Inflammation/Immunology Disease Research Fields Litsea cubeba (Lour.) Pers.	RANKL/RANK
Boldine (Standard) is the analytical standard of Boldine. This product is intended for research and analytical applications. Boldine is an aporphine isoquinoline alkaloid extracted from the root of Litsea cubeba and also possesses these properties, including antioxidant, anti-inflammatory and cytoprotective effects. Boldine suppresses osteoclastogenesis, improves bone destruction by down-regulating the OPG/RANKL/RANK signal pathway and may be a potential therapeutic agent for rheumatoid arthritis .

Cat. No.	Product Name	Chemical Structure

HY-114169S

WRG-28-d5
WRG-28-d5 is the deuterium labeled WRG-28(HY-114169).WRG-28 is a selective, extracellularly acting DDR2 allosteric inhibitor, with an IC₅₀ of 230 nM. WRG-28 inhibits tumor invasion, migration and tumor-supporting effects of cancer-associated fibroblasts (CAFs). WRG-28 inhibits metastatic

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

destruction

Inhibitors & Agonists

Screening Libraries

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

NaturalProducts

Isotope-Labeled Compounds

Natural
Products