1. Search Result
Search Result
Results for "

destruction

" in MedChemExpress (MCE) Product Catalog:

42

Inhibitors & Agonists

3

Screening Libraries

1

Biochemical Assay Reagents

11

Peptides

5

Inhibitory Antibodies

5

Natural
Products

1

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-19364
    Ferroquine
    2 Publications Verification

    Ferrochloroquine; SSR97193

    Parasite Infection
    Ferroquine (Ferrochloroquine), a ferrocenyl analogue of Chloroquine, is an antimalarial agent. Ferroquine shows parasiticidal effect on Plasmodium by inducing oxidative stress and the subsequent destruction of the membrane .
    Ferroquine
  • HY-17644

    LUZ11; F2BMet

    Reactive Oxygen Species Cancer
    Redaporfin (LUZ11) acts as a potent photosensitizer. Redaporfin causes direct antineoplastic effects as well as indirect immune-dependent destruction of malignant lesions .
    Redaporfin
  • HY-128380

    N-​(2-​Chloroethyl)​dibenzylamine hydrochloride

    Adrenergic Receptor Metabolic Disease
    Dibenamine hydrochloride is a competitive and irreversible adrenergic blocking agent and is known to modify the pharmacological effects of epinephrine. Dibenamine hydrochloride cause a significant increase in the rate of destruction of I-epinephrine in the mouse .
    Dibenamine hydrochloride
  • HY-108004

    Septefril; Decametoxin

    Bacterial Fungal Infection
    Decamethoxine (Septefril) is a cationic gemini surfactant. Decamethoxine exhibits strong bactericidal and fungicidal effects. Decamethoxine modifies the permeability of the microbial cell membrane, resulting in the destruction and death of diverse microorganisms .
    Decamethoxine
  • HY-128075

    Others Cancer
    Acifluorfen, a protoporphyrinogen oxidase (PROTOX) inhibitor herbicide, promotes the accumulation of protoporphyrin IX (PPIX), and induces tumors in the rodent liver. Acifluorfen causes strong photooxidative destruction of pigments and lipids in sensitive plant species .
    Acifluorfen
  • HY-156996

    Others Inflammation/Immunology Cancer
    AGI-134 is a fully synthetic alpha-Gal glycolipid. AGI-134 invokes CD8+ T cell-mediated immunity. AGI-134 induces tumor cell destruction and phagocytosis .
    AGI-134
  • HY-N9794

    Others Inflammation/Immunology
    Isoboldine is a pyridine alkaloid. Isoboldine effectively alleviates inflammation and joint destruction in collagen-induced arthritis in mice .
    Isoboldine
  • HY-N12740

    MEK ERK Others
    Napyradiomycin B4 is a Napyradiomycin derivative, which inhibits the RANKL-induced MEK-ERK signaling pathway. Napyradiomycin B4 attenuates osteoclastogenesis and prevents alveolar bone destruction in experimental periodontitis .
    Napyradiomycin B4
  • HY-P0009

    SB-75

    GnRH Receptor Endocrinology
    Cetrorelix is a potent gonadotrophin-releasing hormone (GnRH) antagonist. Cetrorelix inhibits the endogenous luteinizing hormone surge during ovarian stimulation. Cetrorelix reduces cyclophosphamide induced ovarian follicular destruction in mice .
    Cetrorelix
  • HY-118985

    Endogenous Metabolite Cancer
    Acifluorfen sodium, a protoporphyrinogen oxidase (PROTOX) inhibitor herbicide, promotes the accumulation of protoporphyrin IX (PPIX), and induces tumors in the rodent liver. Acifluorfen sodium causes strong photooxidative destruction of pigments and lipids in sensitive plant species .
    Acifluorfen sodium
  • HY-114996
    ADAMTS-5 Inhibitor
    3 Publications Verification

    ADAMTS Inflammation/Immunology
    ADAMTS-5 Inhibitor is a potent ADAMTS-5 (aggrecanase-2) inhibitor, with an IC50 of 1.1 µM. ADAMTS-5 Inhibitor shows >40-fold functional selectivity over ADAMTS-4 (aggrecanase-1) .
    ADAMTS-5 Inhibitor
  • HY-106431

    Olpadronate; OLP

    Others Metabolic Disease Cancer
    Olpadronic acid (Olpadronate) is an orally active amino-bisphosphonate and inhibits bone resorption. Olpadronic acid also prevents bone destruction and tumor growth in the skeletal prostate cancer mouse model. Olpadronic acid can be used for research of osteoporosis, malignancies and rheumatoid arthritis .
    Olpadronic acid
  • HY-24574

    (E)-Octadec-5-ene

    Others Endocrinology
    (E)-5-Octadecene ((E)-Octadec-5-ene) is a sex pheromone or a related chemical component. (E)-5-Octadecene has effect on destruction of sexual attraction of female moth of rice borers moth (Chilo suppressalis Walker) .
    (E)-5-Octadecene
  • HY-131890

    DNA Alkylator/Crosslinker E3 Ligase Ligand-Linker Conjugates Cancer
    VH032 amide-PEG1-acid (linker 10) is a VHL-1 alkyl linker that can be used to bind CDK4/6 ligands (PI) and degradation/destruction tags (EL) (e.g.,E3 ligase ligands) .
    VH032 amide-PEG1-acid
  • HY-136990

    Others Cancer
    GLPG0259 is a ATP-competitive inhibitor of MAPK-activated protein kinase 5 (MK5) with oral activity. GLPG0259 reduces inflammation and bone destruction in a mouse model of collagen-induced arthritis. GLPG0259 also inhibited the metastasis of prostate cancer (PCa) cells .
    GLPG0259
  • HY-N0070
    Solasonine
    2 Publications Verification

    Ferroptosis Glutathione Peroxidase Reactive Oxygen Species Cancer
    Solasonine is a ferroptosis inducer which can be isolated from Solanum melongena that has anti-infection, anti-cancer, and neurogenesis promoting properties. Solasonine promotes ferroptosis of HCC cells via destruction of the glutathione redox system induced by inhibiting GPX4, and can be used for cancer research .
    Solasonine
  • HY-128075R

    Others Cancer
    Acifluorfen (Standard) is the analytical standard of Acifluorfen. This product is intended for research and analytical applications. Acifluorfen, a protoporphyrinogen oxidase (PROTOX) inhibitor herbicide, promotes the accumulation of protoporphyrin IX (PPIX), and induces tumors in the rodent liver. Acifluorfen causes strong photooxidative destruction of pigments and lipids in sensitive plant species .
    Acifluorfen (Standard)
  • HY-B0636
    Triamcinolone acetonide
    4 Publications Verification

    Glucocorticoid Receptor FGFR Cardiovascular Disease Inflammation/Immunology Endocrinology Cancer
    Triamcinolone acetonide inhibits basic fibroblast growth factor (bFGF) induced proliferation of retinal endothelial cells. Triamcinolone acetonide reduces chondrocyte viability and leads to cartilage destruction. Triamcinolone acetonide activates macrophage with anti-inflammatory characteristics. Triamcinolone acetonide can be used in the study of diseases such as atopic dermatitis .
    Triamcinolone acetonide
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-154993

    Fungal Infection
    Gamma-Glutamyl Transferase-IN-1 (compound 4de) is a β-carboline 1-hydrazide inhibitor with antifungal and antibacterial activities, targeting to glutamyltransferase. Gamma-Glutamyl Transferase-IN-1 acts function by resulting the accumulation of reactive oxygen species, destruction of cell membranes, and dysregulation of histone acetylation .
    Gamma-Glutamyl Transferase-IN-1
  • HY-154996

    Fungal Infection
    Gamma-Glutamyl Transferase-IN-2 (compound 4dq) is a β-carboline 1-hydrazide inhibitor with antifungal and antibacterial activities, targeting to glutamyltransferase. Gamma-Glutamyl Transferase-IN-2 acts function by resulting the accumulation of reactive oxygen species, destruction of cell membranes, and dysregulation of histone acetylation .
    Gamma-Glutamyl Transferase-IN-2
  • HY-W127809

    Biochemical Assay Reagents Others
    Chlorin e4 is an organic compound belonging to the family of chlorins, which are macrocyclic compounds with a similar structure to porphyrins. It is commonly used to improve photodynamic therapy for cancer and other diseases. Chlorin e4 has multiple applications in medical research, including as a photosensitizer for localized tumor destruction. In addition, its antimicrobial properties and potential use in disinfection applications were investigated.
    Chlorin e4
  • HY-P2612A

    TNF Receptor Others Cancer
    WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
    WP9QY TFA
  • HY-146421

    NO Synthase NF-κB Reactive Oxygen Species Inflammation/Immunology
    Anti-inflammatory agent 21 (compound 9o) is an orally active and low cytotoxic anti-inflammatory agent, with an IC50 value of 0.76 μM for NO. Anti-inflammatory agent 21 acts via accumulation ROS and blocks the NF-κB/MAPK signaling pathway. Anti-inflammatory agent 21 can ameliorate cartilage destruction and inflammatory cell infiltration in arthritis rats model .
    Anti-inflammatory agent 21
  • HY-P99259

    FPA 008; Anti-Human CSF1R Recombinant Antibody

    c-Fms Inflammation/Immunology Cancer
    Cabiralizumab (FPA 008) is an anti-CSF1R monoclonal antibody (MAb). Cabiralizumab enhances T cell infiltration and antitumor T cell immune responses. Cabiralizumab inhibits the activation of osteoclasts and blocks bone destruction, and can be used in the research of rheumatoid arthritis (RA). Cabiralizumab can combine with Nivolumab (HY-P9903) for lung cancer research .
    Cabiralizumab
  • HY-P2612

    TNF Receptor Others
    WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
    WP9QY
  • HY-N6973R

    RANKL/RANK Inflammation/Immunology
    Boldine (Standard) is the analytical standard of Boldine. This product is intended for research and analytical applications. Boldine is an aporphine isoquinoline alkaloid extracted from the root of Litsea cubeba and also possesses these properties, including antioxidant, anti-inflammatory and cytoprotective effects. Boldine suppresses osteoclastogenesis, improves bone destruction by down-regulating the OPG/RANKL/RANK signal pathway and may be a potential therapeutic agent for rheumatoid arthritis .
    Boldine (Standard)
  • HY-P10438

    Raf Cancer
    Tat-braftide is a peptide inhibitor designed to block the dimerization of BRAF, thereby inhibiting its kinase activity. The destruction of BRAF dimer by Tat-braftide makes BRAF protein more susceptible to proteasome degradation, directly inhibits the activity of BRAF kinase, and reduces the activation of MAPK signaling pathway. Tat-braftide can be used for the role of RAF kinase in MAPK signaling pathway and for the study of BRAF mutant cancers .
    Tat-braftide
  • HY-P4191A

    CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) (acetate)
  • HY-P10370

    Bacterial Apoptosis Infection Cancer
    d-(KLAKLAK)2, as an antibacterial and anti-tumor polypeptide, is a representative of the antimicrobial peptide group, and also has good anticancer properties. d-(KLAKLAK)2 is able to kill bacteria by damaging their cell membranes, causing cell contents to leak out. d-(KLAKLAK)2 can also inhibit tumor cell proliferation by causing mitochondrial swelling and mitochondrial membrane destruction, triggering apoptosis (programmed cell death) .
    d-(KLAKLAK)2, Proapoptotic Peptide
  • HY-P99625

    SAR441344; INX-021

    TNF Receptor Inflammation/Immunology
    Frexalimab (SAR441344) is a second-generation monoclonal antibody targeting the CD40 ligand (CD40L) with a good safety profile. Frexalimab inhibits the binding between CD40 and CD40L to modulate immune response. Frexalimab is likely to help prevent the process of β-cell destruction. Frexalimab is proming for multiple sclerosis, lupus erythematosus, Sjögren’s syndrome and type I diabetes research .
    Frexalimab
  • HY-10408
    Ki20227
    5 Publications Verification

    c-Fms VEGFR c-Kit PDGFR Inflammation/Immunology
    Ki20227 is an orally active and highly selective c-Fms tyrosine kinase (CSF1R) inhibitor with IC50s of 2 nM, 12 nM, 451 and 217 nM for CSF1R, VEGFR2 (vascular endothelial growth factor receptor-2), c-Kit (stem cell factor receptor) and PDGFRβ (platelet-derived growth factor receptor β). Ki20227 suppresses osteoclast differentiation and osteolytic bone destruction .
    Ki20227
  • HY-N6973
    Boldine
    1 Publications Verification

    RANKL/RANK Apoptosis Inflammation/Immunology Cancer
    Boldine is an apomorphine isoquinoline alkaloid extracted from the root of the pheasant pepper (Litsea cubeba). Boldine is an oral effective antioxidant, anti-inflammatory, antitumor agent, and can inhibit osteoclast formation. Boldine induces apoptosis of human bladder cancer cells by regulating ERK, AKT and GSK-3β. Boldine ameliorates bone destruction by down-regulating the OPG/RANKL/RANK signaling pathway. It can be used in rheumatoid arthritis research .
    Boldine
  • HY-P99111

    CNTO-148

    TNF Receptor Apoptosis Interleukin Related Caspase Inflammation/Immunology Cancer
    Golimumab (CNTO-148) is a potent human IgG1 TNFα antagonist monoclonal antibody. Golimumab has anti-inflammation activitity and inhibits IL-6 and IL-1β production. Golimumab acts via targeting and neutralizing TNF to prevent inflammation and destruction of cartilage and bone. Golimumab has the anticancer activity and induces cell apoptosis. Golimumab can be used for rheumatoid arthritis, Crohn's disease and cancer research .
    Golimumab
  • HY-105048A

    Bacterial Infection
    Omiganan pentahydrochloride is a cationic peptide compound with a broad antibacterial profile. Omiganan pentahydrochloride is capable of inhibiting a variety of bacteria, including yeast, and is active against both gram-positive and gram-negative bacteria. Omiganan pentahydrochloride is able to interact with the bacterial cell membrane, causing the destruction of the cell membrane and the death of the bacteria. Omiganan pentahydrochloride can be used for the study of antimicrobial activity against pathogens commonly associated with catheter-associated infections, including strains with drug-resistant phenotypes .
    Omiganan pentahydrochloride
  • HY-114169

    Discoidin Domain Receptor Inflammation/Immunology Cancer
    WRG-28 is a selective, extracellularly acting DDR2 allosteric inhibitor, with an IC50 of 230 nM. WRG-28 inhibits tumor invasion, migration and tumor-supporting effects of cancer-associated fibroblasts (CAFs). WRG-28 inhibits metastatic breast tumor cell colonization in the lungs. WRG-28 also shows good activity of relieving rheumatoid arthritis in CAIA model of mice .
    WRG-28
  • HY-124958

    NF-κB Dipeptidyl Peptidase Metabolic Disease Inflammation/Immunology
    NDMC101 is a potent osteoclastogenesis inhibitor and inhibits osteoclast differentiation via down-regulation of NFATc1-modulated gene expression. NDMC101 is similar to the DPP4 substrate and is a significant inhibitor of early T-cell activation via DPP4 inhibition. NDMC101can be used for study of bone disorders, such as rheumatoid arthritis, and synovial inflammation et al .
    NDMC101
  • HY-114169S

    Isotope-Labeled Compounds Cancer
    WRG-28-d5 is the deuterium labeled WRG-28(HY-114169).WRG-28 is a selective, extracellularly acting DDR2 allosteric inhibitor, with an IC50 of 230 nM. WRG-28 inhibits tumor invasion, migration and tumor-supporting effects of cancer-associated fibroblasts (CAFs). WRG-28 inhibits metastatic
    WRG-28-d5
  • HY-P99605

    PRS 343

    EGFR TNF Receptor Cancer
    Cinrebafusp alfa (PRS 343) is a high affinity CD137/HER2 bispecfic anticalin-based drug. Cinrebafusp alfa binds to recombinant human HER2 (Kd=0.3 nM) and human monomeric CD137 (4-1BB; Kd=5 nM). Cinrebafusp alfa facilitates T-cell costimulation by tumor-localized, HER2-dependent 4-1BB clustering and activation, further enhancing T-cell receptor-mediated activity and leading to tumor destruction. Cinrebafusp alfa has the potential for HER2+ solid tumors research .
    Cinrebafusp alfa
  • HY-P10388

    CD47 TGF-β Receptor Cancer
    TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
    TAX2 peptide
  • HY-162818

    Bacterial Reactive Oxygen Species Infection
    Antibacterial agent 237 (compound Ru-8) is a bacteriostatic agent for Staphylococcus aureus, with MIC of 0.78-1.56 μg/mL. Antibacterial agent 237 destroys bacterial cell membranes, changes their permeability, and induces bacteria to produce Reactive Oxygen Species, leading to bacterial death without causing drug resistance. Antibacterial agent 237 has low hemolytic toxicity to rabbit red blood cells and Raw 264.7 cells, and has significant antibacterial effects against Staphylococcus aureus in mouse skin wound infection models and Bacillus major larvae infection models .
    Antibacterial agent 237
  • HY-W129441

    N-Ac-4-S-CAP

    Others Others
    N-Acetyl-4-S-mercaptoaminophenol (N-Ac-4-S-CAP) is a compound that is selectively cytotoxic to melanocytes of black mouse hair follicles. It can cause 98% depigmentation of black mouse hair follicles. N-Ac-4-S-CAP can produce visible changes in hair follicle melanocytes 4 hours after intraperitoneal injection, including aggregation of melanin granules and nuclear condensation. Electron microscopy observations showed that it caused progressive destruction of melanocytes, including swelling of membranous organelles, nuclear condensation, and cytoplasmic vacuolation, ultimately leading to complete cell necrosis. N-Ac-4-S-CAP has a specific cytotoxic effect on melanocytes that actively produce eumelanin, but may not affect precursor or dormant melanocytes. These properties suggest that N-Ac-4-S-CAP may have potential application value in the treatment of melanoma or skin whitening.
    N-Acetyl-4-S-cysteaminylphenol

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: