1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. HDAC6 Protein, Human (His-SUMO)

The HDAC6 protein coordinates multiple functions, deacetylating histones and proteins such as tubulin and CTTN. Its role in epigenetic repression affects transcription, cell cycle, and development. HDAC6 Protein, Human (His-SUMO) is the recombinant human-derived HDAC6 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

HDAC6 Protein, Human (His-SUMO) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HDAC6 protein coordinates multiple functions, deacetylating histones and proteins such as tubulin and CTTN. Its role in epigenetic repression affects transcription, cell cycle, and development. HDAC6 Protein, Human (His-SUMO) is the recombinant human-derived HDAC6 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

The HDAC6 protein assumes a multifaceted role, primarily responsible for the deacetylation of lysine residues on the N-terminal portion of core histones (H2A, H2B, H3, and H4), contributing to the epigenetic repression that plays crucial roles in transcriptional regulation, cell cycle progression, and developmental events. Operating within large multiprotein complexes, histone deacetylases, including HDAC6, orchestrate these processes. Beyond histones, HDAC6 extends its deacetylation activity to diverse proteins, such as tubulin, essential for microtubule-dependent cell motility, and alpha-tubulin, pivotal for cilia disassembly. Additionally, HDAC6 facilitates actin polymerization and autophagosome-lysosome fusion by deacetylating CTTN, promoting autophagy completion. Its involvement in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer and promotion of odontoblast differentiation showcase its diverse functions. Furthermore, HDAC6 plays a key role in the degradation of misfolded proteins, acting as an adapter to recognize polyubiquitinated misfolded proteins and targeting them to the aggresome for clearance via autophagy when the chaperone refolding system and the ubiquitin-proteasome are insufficient.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

Q9UBN7-1 (M1-N488)

Gene ID
Molecular Construction
N-term
6*His-SUMO
HDAC6 (M1-N488)
Accession # Q9UBN7-1
C-term
Synonyms
CPBHM; FLJ16239; HD 6; HD6; HDAC 6; HDAC6; HDAC6_HUMAN; Histone deacetylase 6 HD6; ; Histone deacetylase 6; JM 21; JM21; KIAA0901; OTTHUMP00000032398; OTTHUMP00000197663; PPP1R90; Protein phosphatase 1 regulatory subunit 90
AA Sequence

MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN

Molecular Weight

Approximately 72 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HDAC6 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HDAC6 Protein, Human (His-SUMO)
Cat. No.:
HY-P72223
Quantity:
MCE Japan Authorized Agent: