1. GPCR/G Protein Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. Peptide YY (PYY) (3-36), porcine

Peptide YY (PYY) (3-36), porcine is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Peptide YY (PYY) (3-36), porcine Chemical Structure

Peptide YY (PYY) (3-36), porcine Chemical Structure

CAS No. : 126339-09-1

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Peptide YY (PYY) (3-36), porcine:

Top Publications Citing Use of Products

View All Neuropeptide Y Receptor Isoform Specific Products:

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Peptide YY (PYY) (3-36), porcine is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.

IC50 & Target

Y2 receptor[1]

In Vitro

Peptide YY (PYY) (3-36), porcine is a Y2 receptor agonist, generated via cleaving the first two amino acids at the N terminus of PYY1-36 by enzyme dipeptidyl peptidase-IV (DPP-IV), and can reduces food intake[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

In mice, actinonin significantly prolongs the anorectic effect of PYY3-36 (50 nmol/kg) and maintains higher PYY3-36 plasma levels than treatment with PYY3-36 alone[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3980.42

Formula

C176H272N52O54

CAS No.
Sequence

Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence Shortening

AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
Purity & Documentation
References
Animal Administration
[1]

Mice[1]
Mice are divided into four treatment groups and administered an injection (maximum volume, 100 μL, sc) of either: 1) saline (n = 10), 2) phosphoramidon (10 mg/kg) (n = 10), 3) PYY3-36 (50 nmol/kg) (n = 10), or 4) PYY3-36 (50 nmol/kg) and phosphoramidon (10 mg/kg) (n = 10). This dose of phosphoramidon inhibits NEP activity for 4 h. Body weight is measured at 0 and 24 h after injection. Food intake is measured at 1, 2, 3, 4, 8, and 24 h after injection[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Peptide YY (PYY) (3-36), porcine
Cat. No.:
HY-P1021
Quantity:
MCE Japan Authorized Agent: