1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Cathepsin
  4. Cathepsin K
  5. Cathepsin K Protein, Human (P.pastoris, His)

Cathepsin K protein is a thiol protease that plays a crucial role in osteoclastic bone resorption and contributes to bone remodeling. Working under acidic conditions, it exhibits potent endoprotease activity, particularly against fibrinogen, suggesting involvement in extracellular matrix degradation. Cathepsin K Protein, Human (P.pastoris, His) is the recombinant human-derived Cathepsin K, expressed by P. pastoris , with N-6*His labeled tag. The total length of Cathepsin K Protein, Human (P.pastoris, His) is 215 a.a.,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cathepsin K protein is a thiol protease that plays a crucial role in osteoclastic bone resorption and contributes to bone remodeling. Working under acidic conditions, it exhibits potent endoprotease activity, particularly against fibrinogen, suggesting involvement in extracellular matrix degradation. Cathepsin K Protein, Human (P.pastoris, His) is the recombinant human-derived Cathepsin K, expressed by P. pastoris , with N-6*His labeled tag. The total length of Cathepsin K Protein, Human (P.pastoris, His) is 215 a.a.,

Background

Cathepsin K Protein, a thiol protease, assumes a crucial role in osteoclastic bone resorption, contributing to the intricate process of bone remodeling. This enzyme exhibits potent endoprotease activity, particularly against fibrinogen, under acidic conditions, suggesting its involvement in extracellular matrix degradation. Furthermore, Cathepsin K plays a role in the regulated release of thyroid hormone thyroxine (T4) through limited proteolysis of TG/thyroglobulin within the thyroid follicle lumen, highlighting its multifaceted functions in physiological processes.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

P43235 (A115-M329)

Gene ID

1513

Synonyms
Cathepsin K; Cathepsin O; Cathepsin O1; Cathepsin O2; Cathepsin X; CATK_HUMAN; CTS02; Ctsk; CTSO; CTSO1; CTSO2; MGC23107; PKND; PYCD
AA Sequence

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Molecular Weight

Observed band size: 100 kDa

Purity

Greater than 90 % as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cathepsin K Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin K Protein, Human (P.pastoris, His)
Cat. No.:
HY-P72156A
Quantity:
MCE Japan Authorized Agent: