Cathepsin K Protein, Human (P.pastoris, His)

Cathepsin K protein is a thiol protease that plays a crucial role in osteoclastic bone resorption and contributes to bone remodeling. Working under acidic conditions, it exhibits potent endoprotease activity, particularly against fibrinogen, suggesting involvement in extracellular matrix degradation. Cathepsin K Protein, Human (P.pastoris, His) is the recombinant human-derived Cathepsin K, expressed by P. pastoris , with N-6*His labeled tag. The total length of Cathepsin K Protein, Human (P.pastoris, His) is 215 a.a.,

Cathepsin K Protein, a thiol protease, assumes a crucial role in osteoclastic bone resorption, contributing to the intricate process of bone remodeling. This enzyme exhibits potent endoprotease activity, particularly against fibrinogen, under acidic conditions, suggesting its involvement in extracellular matrix degradation. Furthermore, Cathepsin K plays a role in the regulated release of thyroid hormone thyroxine (T4) through limited proteolysis of TG/thyroglobulin within the thyroid follicle lumen, highlighting its multifaceted functions in physiological processes.

Human

P. pastoris

N-6*His

P43235 (A115-M329)

1513

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

25.5 kDa

Greater than 90 % as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.