Hemopexin Protein, Rat (His)

Hemopexin Protein, with its heme-binding ability, acts as a transporter, facilitating heme transport to the liver. In the liver, heme is broken down, and the recovered iron is utilized. The liberated hemopexin protein then returns to circulation, underscoring its vital role in efficiently managing heme and iron metabolism in the body. Hemopexin Protein, Rat (His) is the recombinant rat-derived Hemopexin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Hemopexin Protein, Rat (His) is 437 a.a., with molecular weight of ~52.9 kDa.

The Hemopexin protein exhibits the ability to bind to heme, serving as a transporter to facilitate its transportation to the liver. Once in the liver, heme is broken down, and the iron is recovered. Subsequently, the hemopexin protein, now free from heme, returns to circulation. This mechanism highlights the crucial role of hemopexin in the efficient management of heme and iron metabolism within the body.

Rat

E. coli

N-6*His

P20059 (N24-Q460)

58917  [NCBI]

NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ

Approximately 52.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.