1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Inter-Alpha-Trypsin Inhibitors (ITI)
  5. ITIH5
  6. ITIH5 Protein, Human (His-SUMO)

The ITIH5 protein was identified as a potential tumor suppressor, indicating its critical role in controlling tumorigenesis. As a tumor suppressor, ITIH5 is expected to counteract uncontrolled cell growth and inhibit or regulate key pathways in tumor development. ITIH5 Protein, Human (His-SUMO) is the recombinant human-derived ITIH5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ITIH5 protein was identified as a potential tumor suppressor, indicating its critical role in controlling tumorigenesis. As a tumor suppressor, ITIH5 is expected to counteract uncontrolled cell growth and inhibit or regulate key pathways in tumor development. ITIH5 Protein, Human (His-SUMO) is the recombinant human-derived ITIH5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

ITIH5 Protein emerges as a potential tumor suppressor, suggesting a crucial role in regulating tumorigenesis. Its designation as a tumor suppressor implies a capacity to counteract the uncontrolled cellular growth characteristic of cancer cells. By inhibiting or modulating key pathways involved in tumor development, ITIH5 may contribute to the maintenance of normal cellular function and prevention of malignant transformation. The characterization of ITIH5 as a putative tumor suppressor underscores its significance in the intricate network of cellular regulatory mechanisms, warranting further investigation into its specific mechanisms of action and potential therapeutic implications in cancer management.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q86UX2 (V35-E161)

Gene ID
Molecular Construction
N-term
ITIH5 (V35-E161)
Accession # Q86UX2
hFc
C-term
Synonyms
ITIH5; KIAA1953; PP14776; UNQ311/PRO354; Inter-alpha-trypsin inhibitor heavy chain H5; ITI heavy chain H5; ITI-HC5; Inter-alpha-inhibitor heavy chain 5
AA Sequence

VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Molecular Weight

Approximately 33 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ITIH5 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ITIH5 Protein, Human (His-SUMO)
Cat. No.:
HY-P71586
Quantity:
MCE Japan Authorized Agent: