1. Recombinant Proteins
  2. Others
  3. SBDS Protein, Human (His)

The SBDS protein is indispensable for ribosome biogenesis and cooperates with EFL1 to trigger GTP-dependent EIF6 release from 60S preribosomes in the cytoplasm. This activates ribosomes, allowing 80S ribosome assembly and recycling of EIF6 to the nucleus. SBDS Protein, Human (His) is the recombinant human-derived SBDS protein, expressed by E. coli , with N-His labeled tag. The total length of SBDS Protein, Human (His) is 250 a.a., with molecular weight of ~30 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SBDS protein is indispensable for ribosome biogenesis and cooperates with EFL1 to trigger GTP-dependent EIF6 release from 60S preribosomes in the cytoplasm. This activates ribosomes, allowing 80S ribosome assembly and recycling of EIF6 to the nucleus. SBDS Protein, Human (His) is the recombinant human-derived SBDS protein, expressed by E. coli , with N-His labeled tag. The total length of SBDS Protein, Human (His) is 250 a.a., with molecular weight of ~30 kDa.

Background

The SBDS protein is essential for the formation of mature ribosomes and the process of ribosome biogenesis. It works in conjunction with EFL1 to trigger the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm. This release activates ribosomes, allowing for the assembly of 80S ribosomes and facilitating the recycling of EIF6 back to the nucleus. In the nucleus, EIF6 is crucial for 60S rRNA processing and nuclear export. The SBDS protein is also necessary for normal protein synthesis levels and may have roles in cellular stress resistance, DNA damage response, and cell proliferation. It associates with the 60S ribosomal subunit and interacts with NPM1, RPA1, PRKDC, NIP7, EFL1, and CLN3. Additionally, it forms a complex with the 60S ribosomal subunit, SBDS, and EFL1.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9Y3A5 (M1-E250)

Gene ID
Molecular Construction
N-term
His
SBDS (M1-E250)
Accession # Q9Y3A5
C-term
Synonyms
Ribosome maturation protein SBDS; SBDS; CGI-97
AA Sequence

MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SBDS Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SBDS Protein, Human (His)
Cat. No.:
HY-P74570
Quantity:
MCE Japan Authorized Agent: