1. Recombinant Proteins
  2. Others
  3. SKP2 Protein, Human (His-SUMO)

SKP2 serves as a substrate recognition component in the SCF E3 ubiquitin-protein ligase complex, directing ubiquitination and proteasomal degradation of key proteins in the cell cycle, signaling, and transcription. It crucially recognizes phosphorylated CDKN1B/p27kip and regulates the G1/S transition. SKP2 Protein, Human (His-SUMO) is the recombinant human-derived SKP2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of SKP2 Protein, Human (His-SUMO) is 424 a.a., with molecular weight of ~63.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SKP2 serves as a substrate recognition component in the SCF E3 ubiquitin-protein ligase complex, directing ubiquitination and proteasomal degradation of key proteins in the cell cycle, signaling, and transcription. It crucially recognizes phosphorylated CDKN1B/p27kip and regulates the G1/S transition. SKP2 Protein, Human (His-SUMO) is the recombinant human-derived SKP2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of SKP2 Protein, Human (His-SUMO) is 424 a.a., with molecular weight of ~63.8 kDa.

Background

SKP2 serves as the substrate recognition component within the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex, orchestrating the ubiquitination and subsequent proteasomal degradation of target proteins pivotal in cell cycle progression, signal transduction, and transcription. It specifically recognizes phosphorylated CDKN1B/p27kip, playing a crucial role in the regulation of the G1/S transition. SKP2's substrate spectrum encompasses proteins like ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9, RAG2, FOXO1, UBP43, YTHDF2, MYC, TOB1, and TAL1, among others. Additionally, SKP2 is involved in the ubiquitin-mediated proteasomal degradation of hepatitis C virus non-structural protein 5A, displaying antiviral activity against the virus. The complex nature of SKP2's interactions underscores its significance in governing diverse cellular processes through targeted protein degradation.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q13309 (M1-L424)

Gene ID
Molecular Construction
N-term
6*His-SUMO
SKP2 (M1-L424)
Accession # Q13309
C-term
Synonyms
CDK2/Cyclin A associated protein p45; Cyclin A/CDK2 associated protein p45; Cyclin-A/CDK2-associated protein p45; F box protein Skp2; F box/LRR repeat protein 1; F-box protein Skp2; F-box/LRR-repeat protein 1; FBL 1; FBL1; FBXL 1; FBXL1; FLB 1; FLB1; MGC1366; p45; p45skp2;
AA Sequence

MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Molecular Weight

Approximately 63.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SKP2 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SKP2 Protein, Human (His-SUMO)
Cat. No.:
HY-P71531
Quantity:
MCE Japan Authorized Agent: