TNFR-1/CD120a Protein, Human (HEK293, His)

The TNFR-1/CD120a protein is a receptor for TNFSF2/TNF-α and TNFSF1/lymphotoxin-α, and initiates caspase-8-mediated apoptosis upon TNF binding. It induces non-cytocidal TNF action, activates acid sphingomyelinase and establishes an antiviral state. TNFR-1/CD120a Protein, Human (HEK293, His) is the recombinant human-derived TNFR-1/CD120a protein, expressed by HEK293 , with C-8*His labeled tag. The total length of TNFR-1/CD120a Protein, Human (HEK293, His) is 182 a.a., with molecular weight of 28-38 kDa.

The TNFR-1/CD120a protein acts as a receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. Upon TNF binding, the adapter molecule FADD recruits caspase-8 to the activated receptor, initiating the formation of the death-inducing signaling complex (DISC). This complex leads to caspase-8 proteolytic activation, triggering subsequent caspase-mediated apoptosis. TNFR-1/CD120a is involved in the induction of non-cytocidal TNF effects, including the establishment of an anti-viral state and activation of acid sphingomyelinase. Homotrimerization of TNFR-1/CD120a upon TNF binding provides a molecular interface for specific interactions with the death domain of TRADD, recruiting various TRADD-interacting proteins such as TRAFS, RIPK1, and possibly FADD. This complex activates distinct signaling cascades, including apoptosis and NF-kappa-B signaling. Additionally, TNFR-1/CD120a interacts with a variety of proteins, including BAG4, BABAM2, FEM1B, GRB2, SQSTM1, TRPC4AP, NOL3, SH3RF2, PGLYRP1, and MADD, playing a role in modulating the TNF-signaling pathway and apoptosis induction.

1.Measured  by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929  mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin  D.The ₅₀ for this effect is 0.06164 μg/mLin the presence of 0.25 ng/mL of  recombinant humanTNF-alpha, corresponding to a specific activity is  1.622×10⁴ units/mg.
2.Anti-His antibody Immobilized on CM5 Chip captured TNFR-1/CD120a His Tag, Human, can bind TNF-α, Human with an affinity constant of 0.106 nM as determined in SPR assay.

Human

HEK293

C-8*His

P19438 (L30-T211)

7132  [NCBI]

LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

28-38kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.