Search Result
Results for "
mimicking
" in MedChemExpress (MCE) Product Catalog:
98
Biochemical Assay Reagents
Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-P5558
-
|
VEGFR
|
Inflammation/Immunology
|
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .
|
-
-
- HY-P1416
-
Foxy-5
4 Publications Verification
|
Wnt
|
Cancer
|
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
|
-
-
- HY-P1416A
-
|
Wnt
|
Cancer
|
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
|
-
-
- HY-P0102
-
|
mAChR
|
Neurological Disease
|
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a mAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate can induce muscle relaxation .
|
-
-
- HY-112416
-
AZD4320
1 Publications Verification
|
Bcl-2 Family
|
Cancer
|
AZD4320 is a novel BH3-mimicking dual BCL2/BCLxL inhibitor with IC50s of 26 nM, 17 nM, and 170 nM for KPUM-MS3, KPUM-UH1, and STR-428 cells, respectively.
|
-
-
- HY-17551
-
NMDA
Maximum Cited Publications
17 Publications Verification
N-Methyl-D-aspartic acid
|
iGluR
Endogenous Metabolite
|
Neurological Disease
|
NMDA is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor.
|
-
-
- HY-P10428
-
|
HPV
|
Infection
|
E6AP-mimicking peptide (compound 13) is a high-affinity, selective, irreversible and potent peptide-based covalent HPV16 E6 inhibitor targeting the 16E6 oncoprotein using a cysteine-reactive acrylamide warhead. E6AP-mimicking peptide has a Ki of 17 nM. E6AP-mimicking peptide targets all residues appearing in the binding pocket of E6 to disrupt the binding interface of 16E6 and E6AP. E6AP-mimicking peptide selectively binds and crosslinks to MBP-16E6 in PBS or a protein mixture .
|
-
-
- HY-W142596
-
|
Liposome
|
Others
|
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .
|
-
-
- HY-158463
-
|
|
Others
|
A2G2S2-KVANKT glycopeptide is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-119274
-
|
Others
|
Neurological Disease
|
BN-82451 dihydrochloride, an orally active and CNS-penetrated antioxidant and a multitargeting neuroprotective agent, exert a significant protection in experimental animal models mimicking aspects of cerebral ischemia, Parkinson disease, Huntington disease, and more particularly amyotrophic lateral sclerosis .
|
-
-
- HY-158516
-
Mannose-6 N-linked oligosaccharide, procainamide labelled; Oligomannose 6 glycan, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
M6 glycan (Man6), procainamide labelled (Mannose-6 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-162467
-
|
Others
|
Others
|
Opabactin is an agonist for abscisic acid (ABA) receptor, which regulates the water use of plants by mimicking the effects of ABA with an IC50 of 7 nM. Opabactin inhibits the seed germination of Arabidopsis with an IC50 of 62 nM. Opabactin induces anti-transpiration response in plant tissue, and improves crop drought tolerance .
|
-
-
- HY-B0867
-
|
Others
|
Others
|
2,4-D Butyl ester is an organic phenoxy herbicide and used to control woody broad-leaf weeds. 2,4-D butyl ester produces its herbicidal effect by mimicking natural plant growth hormones causing plants to grow too rapidly to survive .
|
-
-
- HY-D2361
-
|
Nucleoside Antimetabolite/Analog
|
Others
|
Adenosine 2'-PEG-Biotin is a biochemical reagent derived from adenosine. Adenosine 2'-PEG-Biotin regulates cell signaling pathways by mimicking the effects of endogenous adenosine and binding to its receptors. Adenosine 2'-PEG-Biotin can be used in the research of bioprobes, biosensors and diagnostic reagents .
|
-
-
- HY-P5371
-
|
Thrombin
|
Others
|
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
|
-
-
- HY-134263
-
|
PKA
Ras
|
Cardiovascular Disease
|
8-Br-cAMP-AM is a cyclic adenosine monophosphate (cAMP) analog that activates two major signal transduction pathways in the heart by mimicking the effects of cAMP: protein kinase A (PKA) and guanosine nucleotide exchange factor (Epac), which is directly activated by cAMP. 8-Br-cAMP-AM can be used to study cardiac ischemia and reperfusion injury .
|
-
-
- HY-126039
-
|
Integrin
|
Cardiovascular Disease
|
L-739758 is an antagonist for αIIbβ3 integrin (platelet glycoprotein IIb/IIIa). L-739758 acts as a peptidomimetic, binds to αIIbβ3 integrin by mimicking the interaction of the RGD (arginine-glycine-aspartic acid) motif, and is involved in the blood coagulation process. L-739758 inhibits platelet aggregation, and is used for thrombosis research .
|
-
-
- HY-126932
-
|
Estrogen Receptor/ERR
|
Cancer
|
TTC-352 is an orally bioavailable selective human estrogen receptor (ER) α partial agonist (ShERPA). TTC-352 inhibits the growth of three TR ER+ breast cancer cell cultures in 3D. TTC-352 induces tumor regression accompanied by exit of ERα from the nucleus to extranuclear sites, mimicking the actions of E2 .
|
-
-
- HY-N2466A
-
MT-I acetate; [Nle4,D-Phe7]-α-MSH acetate
|
Melanocortin Receptor
|
Cancer
|
Melanotan I acetate is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I acetate is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I acetate can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I acetate can be used for sunlight-induced skin cancers research .
|
-
-
- HY-P3431
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
-
- HY-129242
-
4-Oxo-Tempo
|
Others
|
Others
|
Tempone (4-Oxo-Tempo) is a stable water-soluble nitro radical. Tempone is widely used as a contrast agent for metabolic activity and hypoxic sensitivity in electron spin resonance spectroscopy, magnetic resonance imaging and dynamic nuclear polarization. Tempone reduces superoxide radicals by mimicking the activity of superoxide dismutase (SOD), thereby reducing the formation of hydroxyl radicals and peroxynitrites. Tempone can be used in the study of ischemia-reperfusion injury and acute renal failure .
|
-
-
- HY-116535B
-
|
Parasite
|
Infection
|
DL-threo-PPMP is an inhibitor of sphingosine synthetase in Plasmodium falciparum. DL-threo-PPMP inhibits the activity of sphingosine synthetase by mimicking the substrate sphingosine. This inhibition leads to a rapid decrease in the activity of sensitive sphingosine synthetase, selectively destroying the interconnected tubular network of TVMs in the host cell cytoplasm, and this inhibition also blocks the proliferation of Plasmodium falciparum. DL-threo-PPMP can be used for the study of Plasmodium biology and the search for new antimalarial strategies .
|
-
-
- HY-B0867R
-
|
Others
|
Others
|
2,4-D Butyl ester (Standard) is the analytical standard of 2,4-D Butyl ester. This product is intended for research and analytical applications. 2,4-D Butyl ester is an organic phenoxy herbicide and used to control woody broad-leaf weeds. 2,4-D butyl ester produces its herbicidal effect by mimicking natural plant growth hormones causing plants to grow too rapidly to survive .
|
-
-
- HY-N2466
-
MT-I; [Nle4,D-Phe7]-α-MSH
|
Melanocortin Receptor
|
Neurological Disease
Cancer
|
Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for the research of sun-induced skin cancer, melanoma, inflammation and male erectile dysfunction .
|
-
-
- HY-P3431A
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
-
- HY-116945
-
|
Endogenous Metabolite
|
Others
|
Diphenamid is a chemical compound that exhibits herbicide activity. Diphenamid acts by inhibiting the enzyme acetyl-CoA carboxylase. Diphenamid has shown resistance as a model for mimicking organic pollutants in wastewater treatment processes, especially in the presence of multiple anions. The degradation of diphenamid is significantly affected by certain inorganic ions, such as chromium (VI) and nitrogen oxides. Diphenamid shows changes in toxicity with longer treatment times, and the results of toxicity tests on selected algae indicate higher toxicity at 240 minutes of treatment .
|
-
-
- HY-130495
-
CDDO-Trifluoethyl amide; RTA 404; TP-500
|
Keap1-Nrf2
Apoptosis
|
Cancer
|
CDDO-TFEA (RTA 404; TP-500) is a trifluoroacetamide derivative of CDDO with enhanced ability to cross the blood-brain barrier. CDDO is an Nrf2 activator that inhibits proliferation and induces differentiation and apoptosis in various cancer cells. CDDO-TFEA can enhance Nrf2 expression and signaling in various neurodegenerative disease models, including those mimicking multiple sclerosis, amyotrophic lateral sclerosis, and Huntington's disease. CDDO-TFEA induces apoptosis and blocks colony formation in Ewing's sarcoma and neuroblastoma cell lines with IC50 values ranging from 85-170 nM.
|
-
-
- HY-P10302
-
|
GLP Receptor
Insulin Receptor
|
Metabolic Disease
|
GLP-1R/GIPR AgonIST-1 is a double-receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulin releasing peptide). GLP-1R/GIPR agonist-1 lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
-
-
- HY-131614
-
|
Calcium Channel
|
Others
|
TPC2-A1-N is a powerful and Ca 2+-permeable agonist of two pore channel 2 (TPC2), which plays its role by mimicking the physiological actions of NAADP. TPC2-A1-P reproducibly evokes significant Ca 2+ responses from TPC2 (EC50=7.8 μM), and the effect can be blocked by several TPC blockers. TPC2-A1-N can be used to probe different functions of TPC2 channels in intact cells .
|
-
-
- HY-N3021
-
|
Endogenous Metabolite
NF-κB
TNF Receptor
FOXO
Microtubule/Tubulin
|
Metabolic Disease
|
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .
|
-
-
- HY-131615
-
|
Sodium Channel
|
Others
|
TPC2-A1-P is a powerful and membrane permeable agonist of two pore channel 2 (TPC2) with an EC50 of 10.5 μM. TPC2-A1-P plays its role by mimicking the physiological actions of PI(3,5)P2. TPC2-A1-P also shows higher potency to induce Na 2+ mobilisation from TPC2 than TPC-A1-N (HY-131614). TPC2-A1-P can be used to probe different functions of TPC2 channels in intact cells .
|
-
-
- HY-P10302A
-
|
GLP Receptor
|
Metabolic Disease
|
GLP-1R/GIPR agonist-1 soduim is the sodium salt form of GLP-1R/GIPR agonist-1 (HY-P10302). GLP-1R/GIPR agonist-1 soduim is a dual agonist for glucagon-like peptide-1 receptor (GLP-1R, EC50 is 0.57 nM) and glucose-dependent insulin releasing peptide receptor (GIPR, EC50 is 0.75 nM). GLP-1R/GIPR agonist-1 soduim lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 soduim can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
-
Cat. No. |
Product Name |
Type |
-
- HY-D2361
-
|
Dyes
|
Adenosine 2'-PEG-Biotin is a biochemical reagent derived from adenosine. Adenosine 2'-PEG-Biotin regulates cell signaling pathways by mimicking the effects of endogenous adenosine and binding to its receptors. Adenosine 2'-PEG-Biotin can be used in the research of bioprobes, biosensors and diagnostic reagents .
|
Cat. No. |
Product Name |
Type |
-
- HY-167815
-
|
Cell Assay Reagents
|
Myo-Inositol hexasulfate hexapotassium is a sulfated derivative of inositol that has the activity of mimicking highly sulfated polysaccharides such as heparin, affecting many cell signaling pathways.
|
-
- HY-158464
-
|
Carbohydrates
|
Fetuin glycoprotein is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158466
-
|
Carbohydrates
|
Human IgG Glycoprotein is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158532
-
A4 N-linked oligosaccharide
|
Carbohydrates
|
A4 glycan (A4 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158528
-
A3 N-linked oligosaccharide
|
Carbohydrates
|
A3 glycan (A3 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-W142596
-
|
Drug Delivery
|
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .
|
-
- HY-158460
-
Galactose-alpha-1,3-galactose
|
Carbohydrates
|
Alpha-Gal (Galactose-alpha-1,3-galactose) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158494
-
A2 N-linked oligosaccharide
|
Carbohydrates
|
A2 glycan (G0) (A2 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158542
-
A4 N-linked oligosaccharide, procainamide labelled
|
Carbohydrates
|
A4 glycan, procainamide labelled (A4 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158531
-
A3 N-linked oligosaccharide, procainamide labelled
|
Carbohydrates
|
A3 glycan, procainamide labelled (A3 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158490
-
A4G4 N-linked oligosaccharide
|
Carbohydrates
|
A4G4 glycan (A4G4 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158472
-
|
Carbohydrates
|
Sialylated Core 1 O-glycan (C1S(3)1) () is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158463
-
|
Carbohydrates
|
A2G2S2-KVANKT glycopeptide is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158482
-
Mannose-3 N-linked oligosaccharide; Oligomannose 3 glycan
|
Carbohydrates
|
M3 glycan (Man3) (Mannose-3 N-linked oligosaccharide; Oligomannose 3 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158519
-
Mannose-7 N-linked oligosaccharide; Oligomannose 7 glycan
|
Carbohydrates
|
M7 glycan (Man7) (Mannose-7 N-linked oligosaccharide; Oligomannose 7 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158493
-
A2 N-linked oligosaccharide, procainamide labelled
|
Carbohydrates
|
A2 glycan (G0), procainamide labelled (A2 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158534
-
Mannose-8 N-linked oligosaccharide; Oligomannose 8 glycan
|
Carbohydrates
|
M8 glycan (Man8) (Mannose-8 N-linked oligosaccharide; Oligomannose 8 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158485
-
Mannose-5 N-linked oligosaccharide; Oligomannose 5 glycan
|
Carbohydrates
|
M5 glycan (Man5) (Mannose-5 N-linked oligosaccharide; Oligomannose 5 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158497
-
A2 N-linked oligosaccharide, APTS labelled
|
Carbohydrates
|
A2 glycan (G0), APTS labelled (A2 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158509
-
Mannose-6 N-linked oligosaccharide; Oligomannose 6 glycan
|
Carbohydrates
|
M6 glycan (Man6) (Mannose-6 N-linked oligosaccharide; Oligomannose 6 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158543
-
Mannose-9 N-linked oligosaccharide; Oligomannose 9 glycan
|
Carbohydrates
|
M9 glycan (Man9) (Mannose-9 N-linked oligosaccharide; Oligomannose 9 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158516
-
Mannose-6 N-linked oligosaccharide, procainamide labelled; Oligomannose 6 glycan, procainamide labelled
|
Carbohydrates
|
M6 glycan (Man6), procainamide labelled (Mannose-6 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158530
-
A3 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A3 glycan, 2-AB labelled (A3 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158529
-
A3 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A3 glycan, 2-AA labelled (A3 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158541
-
A4 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A4 glycan, 2-AB labelled (A4 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158468
-
|
Carbohydrates
|
Sialylated Core 1 O-glycan (C1S(3)1), 2AB labelled () is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158540
-
A4 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A4 glycan, 2-AA labelled (A4 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158446
-
A2G2 N-linked oligosaccharide, APTS labelled
|
Carbohydrates
|
A2G2 glycan (G2), APTS labelled (A2G2 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158496
-
A2 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A2 glycan (G0), 2-AB labelled (A2 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158498
-
FA2 N-linked oligosaccharide; F(6)A2 glycan
|
Carbohydrates
|
FA2 glycan (G0F) (FA2 N-linked oligosaccharide; F(6)A2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158462
-
Galactose-alpha-1,3-galactose, 2-AB labelled
|
Carbohydrates
|
Alpha-Gal standard, 2-AB labelled (Galactose-alpha-1,3-galactose, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158461
-
Galactose-alpha-1,3-galactose, 2-AA labelled
|
Carbohydrates
|
Alpha-Gal standard, 2-AA labelled (Galactose-alpha-1,3-galactose, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158505
-
Mannose-5 N-linked oligosaccharide, APTS labelled; Oligomannose 5 glycan, APTS labelled
|
Carbohydrates
|
M5 glycan (Man5), APTS labelled (Mannose-5 N-linked oligosaccharide, APTS labelled; Oligomannose 5 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158526
-
Mannose-7 N-linked oligosaccharide, procainamide labelled; Oligomannose 7 glycan, procainamide labelled
|
Carbohydrates
|
M7 glycan (Man7), procainamide labelled (Mannose-7 N-linked oligosaccharide, procainamide labelled; Oligomannose 7 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158507
-
Mannose-5 N-linked oligosaccharide, procainamide labelled; Oligomannose 5 glycan, procainamide labelled
|
Carbohydrates
|
M5 glycan (Man5), procainamide labelled (Mannose-5 N-linked oligosaccharide, procainamide labelled; Oligomannose 5 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158537
-
A3G3S3 N-linked oligosaccharide, procainamide labelled
|
Carbohydrates
|
A3G3S3 glycan, procainamide labelled (A3G3S3 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158539
-
Mannose-8 N-linked oligosaccharide, procainamide labelled; Oligomannose 8 glycan, procainamide labelled
|
Carbohydrates
|
M8 glycan (Man8), procainamide labelled (Mannose-8 N-linked oligosaccharide, procainamide labelled; Oligomannose 8 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158546
-
Mannose-9 N-linked oligosaccharide, procainamide labelled; Oligomannose 9 glycan, procainamide labelled
|
Carbohydrates
|
M9 glycan (Man9), procainamide labelled (Mannose-9 N-linked oligosaccharide, procainamide labelled; Oligomannose 9 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158491
-
A4G4 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A4G4 glycan, 2-AA labelled (A4G4 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158492
-
A4G4 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A4G4 glycan, 2-AB labelled (A4G4 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158442
-
A2G2 N-linked oligosaccharide; A2G(4)2 glycan
|
Carbohydrates
|
A2G2 glycan (G2) (A2G2 N-linked oligosaccharide; A2G(4)2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158488
-
A3G3 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A3G3 glycan (G3), 2-AB labelled (A3G3 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158445
-
A2G2 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A2G2 glycan (G2), 2-AB labelled (A2G2 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158444
-
A2G2 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A2G2 glycan (G2), 2-AA labelled (A2G2 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158452
-
A3G3 N-linked oligosaccharide; A3G(4)3 glycan
|
Carbohydrates
|
A3G3 glycan (G3) (A3G3 N-linked oligosaccharide; A3G(4)3 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158487
-
A3G3 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A3G3 glycan (G3), 2-AA labelled (A3G3 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158465
-
F(3)A2 glycan-KVANKT & F(6)A2 glycan-KVANKT
|
Carbohydrates
|
GPEP FA2-KVANKT glycopeptide (F(3)A2 glycan-KVANKT & F(6)A2 glycan-KVANKT) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158504
-
FA2G2S1 N-linked oligosaccharide, APTS labelled
|
Carbohydrates
|
FA2G2S1 glycan (G2FS1), APTS labelled (FA2G2S1 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158448
-
FA2G2 N-linked oligosaccharide; F(6)A2G2
|
Carbohydrates
|
FA2G2 glycan (G2F) (FA2G2 N-linked oligosaccharide; F(6)A2G2) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158533
-
A3G3S3 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A3G3S3 glycan, 2-AA labelled (A3G3S3 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158535
-
A3G3S3 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A3G3S3 glycan, 2-AB labelled (A3G3S3 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158527
-
FA2 N-linked oligosaccharide, APTS labelled; F(6)A2 glycan, APTS labelled
|
Carbohydrates
|
FA2 glycan (G0F), APTS labelled (FA2 N-linked oligosaccharide, APTS labelled; F(6)A2 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158474
-
A2G2S1 N-linked oligosaccharide, APTS labelled
|
Carbohydrates
|
A2G2S1 glycan (G2S1), APTS labelled (A2G2S1 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158545
-
Mannose-9 N-linked oligosaccharide, 2-AB labelled; Oligomannose 9 glycan, 2-AB labelled
|
Carbohydrates
|
M9 glycan (Man9), 2-AB labelled (Mannose-9 N-linked oligosaccharide, 2-AB labelled; Oligomannose 9 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158514
-
Mannose-6 N-linked oligosaccharide, 2-AB labelled; Oligomannose 6 glycan, 2-AB labelled
|
Carbohydrates
|
M6 glycan (Man6), 2-AB labelled (Mannose-6 N-linked oligosaccharide, 2-AB labelled; Oligomannose 6 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158483
-
Mannose-3 N-linked oligosaccharide, 2-AA labelled; Oligomannose 3 glycan, 2-AA labelled
|
Carbohydrates
|
M3 glycan (Man3), 2-AA labelled (Mannose-3 N-linked oligosaccharide, 2-AA labelled; Oligomannose 3 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158484
-
Mannose-3 N-linked oligosaccharide, 2-AB labelled; Oligomannose 3 glycan, 2-AB labelled
|
Carbohydrates
|
M3 glycan (Man3), 2-AB labelled (Mannose-3 N-linked oligosaccharide, 2-AB labelled; Oligomannose 3 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158536
-
Mannose-8 N-linked oligosaccharide, 2-AA labelled; Oligomannose 8 glycan, 2-AA labelled
|
Carbohydrates
|
M8 glycan (Man8), 2-AA labelled (Mannose-8 N-linked oligosaccharide, 2-AA labelled; Oligomannose 8 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158538
-
Mannose-8 N-linked oligosaccharide, 2-AB labelled; Oligomannose 8 glycan, 2-AB labelled
|
Carbohydrates
|
M8 glycan (Man8), 2-AB labelled (Mannose-8 N-linked oligosaccharide, 2-AB labelled; Oligomannose 8 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158524
-
Mannose-7 N-linked oligosaccharide, 2-AB labelled; Oligomannose 7 glycan, 2-AB labelled
|
Carbohydrates
|
M7 glycan (Man7), 2-AB labelled (Mannose-7 N-linked oligosaccharide, 2-AB labelled; Oligomannose 7 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158544
-
Mannose-9 N-linked oligosaccharide, 2-AA labelled; Oligomannose 9 glycan, 2-AA labelled
|
Carbohydrates
|
M9 glycan (Man9), 2-AA labelled (Mannose-9 N-linked oligosaccharide, 2-AA labelled; Oligomannose 9 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158511
-
Mannose-6 N-linked oligosaccharide, 2-AA labelled; Oligomannose 6 glycan, 2-AA labelled
|
Carbohydrates
|
M6 glycan (Man6), 2-AA labelled (Mannose-6 N-linked oligosaccharide, 2-AA labelled; Oligomannose 6 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158521
-
Mannose-7 N-linked oligosaccharide, 2-AA labelled; Oligomannose 7 glycan, 2-AA labelled
|
Carbohydrates
|
M7 glycan (Man7), 2-AA labelled (Mannose-7 N-linked oligosaccharide, 2-AA labelled; Oligomannose 7 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158501
-
Mannose-5 N-linked oligosaccharide, 2-AA labelled; Oligomannose 5 glycan, 2-AA labelled
|
Carbohydrates
|
M5 glycan (Man5), 2-AA labelled (Mannose-5 N-linked oligosaccharide, 2-AA labelled; Oligomannose 5 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158503
-
Mannose-5 N-linked oligosaccharide, 2-AB labelled; Oligomannose 5 glycan, 2-AB labelled
|
Carbohydrates
|
M5 glycan (Man5), 2-AB labelled (Mannose-5 N-linked oligosaccharide, 2-AB labelled; Oligomannose 5 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158502
-
FA2G2S1 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
FA2G2S1 glycan (G2FS1), 2-AB labelled (FA2G2S1 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158486
-
FA2G2S1 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
FA2G2S1 glycan (G2FS1), 2-AA labelled (FA2G2S1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158443
-
A2G2S1 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A2G2S1 glycan (G2S1), 2-AB labelled (A2G2S1 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158489
-
A3G3 N-linked oligosaccharide, procainamide labelled; A3G(4)3 glycan, procainamide labelled
|
Carbohydrates
|
A3G3 glycan (G3), procainamide labelled (A3G3 N-linked oligosaccharide, procainamide labelled; A3G(4)3 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158447
-
A2G2 N-linked oligosaccharide, procainamide labelled; A2G(4)2 glycan, procainamide labelled
|
Carbohydrates
|
A2G2 glycan (G2), procainamide labelled (A2G2 N-linked oligosaccharide, procainamide labelled; A2G(4)2 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158441
-
A2G2S1 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A2G2S1 glycan (G2S1), 2-AA labelled (A2G2S1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158453
-
FA2B N-linked oligosaccharide, 2-AA labelled; G0F with bisecting GlcNAc, 2-AA labelled
|
Carbohydrates
|
FA2B glycan (G0B), 2-AA labelled (FA2B N-linked oligosaccharide, 2-AA labelled; G0F with bisecting GlcNAc, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158499
-
FA2 N-linked oligosaccharide, 2-AA labelled; F(6)A2 glycan, 2-AA labelled
|
Carbohydrates
|
FA2 glycan (G0F), 2-AA labelled (FA2 N-linked oligosaccharide, 2-AA labelled; F(6)A2 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158454
-
FA2B N-linked oligosaccharide, 2-AB labelled; G0F with bisecting GlcNAc, 2-AB labelled
|
Carbohydrates
|
FA2B glycan (G0B), 2-AB labelled (FA2B N-linked oligosaccharide, 2-AB labelled; G0F with bisecting GlcNAc, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158500
-
FA2 N-linked oligosaccharide, 2-AB labelled; F(6)A2 glycan, 2-AB labelled
|
Carbohydrates
|
FA2 glycan (G0F), 2-AB labelled (FA2 N-linked oligosaccharide, 2-AB labelled; F(6)A2 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158451
-
FA2G2 N-linked oligosaccharide, APTS labelled; F(6)A2G2, APTS labelled
|
Carbohydrates
|
FA2G2 glycan (G2F), APTS labelled (FA2G2 N-linked oligosaccharide, APTS labelled; F(6)A2G2, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158475
-
A2G2S1 N-linked oligosaccharide; A2G(4)2S(6)1 glycan
|
Carbohydrates
|
A2G2S1 glycan (G2S1) (A2G2S1 N-linked oligosaccharide; A2G(4)2S(6)1 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158506
-
A2G2S2 N-linked oligosaccharide; A2G(4)2S(6)2 glycan
|
Carbohydrates
|
A2G2S2 glycan (G2S2) (A2G2S2 N-linked oligosaccharide; A2G(4)2S(6)2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158449
-
FA2G2 N-linked oligosaccharide, 2-AA labelled; F(6)A2G2, 2-AA labelled
|
Carbohydrates
|
FA2G2 glycan (G2F), 2-AA labelled (FA2G2 N-linked oligosaccharide, 2-AA labelled; F(6)A2G2, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158450
-
FA2G2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G2, 2-AB labelled
|
Carbohydrates
|
FA2G2 glycan (G2F), 2-AB labelled (FA2G2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G2, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158513
-
FA2G2S2 N-linked oligosaccharide; F(6)A2G(4)2S(6)2 glycan
|
Carbohydrates
|
FA2G2S2 glycan (G2FS2) (FA2G2S2 N-linked oligosaccharide; F(6)A2G(4)2S(6)2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158473
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide
|
Carbohydrates
|
FA2[3]G1 & FA2[6]G1 glycan (G1F) (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158510
-
A2G2S2 N-linked oligosaccharide, APTS labelled; A2G(4)2S(6)2 glycan, APTS labelled
|
Carbohydrates
|
A2G2S2 glycan (G2S2), APTS labelled (A2G2S2 N-linked oligosaccharide, APTS labelled; A2G(4)2S(6)2 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158523
-
A2[3]G1 & A2[6]G1 N-linked oligosaccharide
|
Carbohydrates
|
A2[3]G1 & A2[6]G1 glycan (G1) (A2[3]G1 & A2[6]G1 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158480
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, procainamide labelled
|
Carbohydrates
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), procainamide labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158479
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, APTS labelled
|
Carbohydrates
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), APTS labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158517
-
FA2G2S2 N-linked oligosaccharide, APTS labelled; F(6)A2G(4)2S(6)2 glycan, APTS labelled
|
Carbohydrates
|
FA2G2S2 glycan (G2FS2), APTS labelled (FA2G2S2 N-linked oligosaccharide, APTS labelled; F(6)A2G(4)2S(6)2 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158515
-
FA2G2S2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G(4)2S(6)2 glycan, 2-AB labelled
|
Carbohydrates
|
FA2G2S2 glycan (G2FS2), 2-AB labelled (FA2G2S2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G(4)2S(6)2 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158481
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), 2-AA labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158508
-
A2G2S2 N-linked oligosaccharide, 2-AA labelled; A2G(4)2S(6)2 glycan, 2-AA labelled
|
Carbohydrates
|
A2G2S2 glycan (G2S2), 2-AA labelled (A2G2S2 N-linked oligosaccharide, 2-AA labelled; A2G(4)2S(6)2 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158478
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), 2-AB labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158512
-
A2G2S2 N-linked oligosaccharide, 2-AB labelled; A2G(4)2S(6)2 glycan, 2-AB labelled
|
Carbohydrates
|
A2G2S2 glycan (G2S2), 2-AB labelled (A2G2S2 N-linked oligosaccharide, 2-AB labelled; A2G(4)2S(6)2 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158518
-
FA2G2S2 N-linked oligosaccharide, 2-AA labelled; F(6)A2G(4)2S(6)2 glycan, 2-AA labelled
|
Carbohydrates
|
FA2G2S2 glycan (G2FS2), 2-AA labelled (FA2G2S2 N-linked oligosaccharide, 2-AA labelled; F(6)A2G(4)2S(6)2 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158520
-
A2[3]G1 & A2[6]G1 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A2[3]G1 & A2[6]G1 glycan (G1), 2-AA labelled (A2[3]G1 & A2[6]G1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158455
-
FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AA labelled; G1F with bisecting GlcNAc, 2-AA labelled
|
Carbohydrates
|
FA2[3]BG1 & FA2[6]BG1 glycan (G1B), 2-AA labelled (FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AA labelled; G1F with bisecting GlcNAc, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158456
-
FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AB labelled; G1F with bisecting GlcNAc, 2-AB labelled
|
Carbohydrates
|
FA2[3]BG1 & FA2[6]BG1 glycan (G1B), 2-AB labelled (FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AB labelled; G1F with bisecting GlcNAc, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158477
-
FA2G2S1 N-linked oligosaccharide; α(2,6)/FA2G2S(6)1 glycan; F(6)A2G(4)2S(6)1 glycan
|
Carbohydrates
|
FA2G2S1 glycan (G2FS1) (FA2G2S1 N-linked oligosaccharide; α(2,6)/FA2G2S(6)1 glycan; F(6)A2G(4)2S(6)1 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158476
-
FA2G2S1 N-linked oligosaccharide, procainamide labelled; α(2,6)/FA2G2S(6)1 glycan, procainamide labelled; F(6)A2G(4)2S(6)1 glycan, procainamide labelled
|
Carbohydrates
|
FA2G2S1 glycan (G2FS1), procainamide labelled (FA2G2S1 N-linked oligosaccharide, procainamide labelled; α(2,6)/FA2G2S(6)1 glycan, procainamide labelled; F(6)A2G(4)2S(6)1 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P5558
-
|
VEGFR
|
Inflammation/Immunology
|
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .
|
-
- HY-P1416
-
Foxy-5
4 Publications Verification
|
Wnt
|
Cancer
|
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
|
-
- HY-P1416A
-
|
Wnt
|
Cancer
|
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
|
-
- HY-P0102
-
|
mAChR
|
Neurological Disease
|
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a mAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate can induce muscle relaxation .
|
-
- HY-P10512
-
|
Peptides
|
Others
|
BDC2.5 mimotope is a potent antigen-mimicking peptide that can activate CD4+ T cell populations that have the same antigen recognition properties as BDC2.5 cells. BDC2.5 mimotope can be used to study the prevention or treatment of type 1 diabetes by targeting specific T cell populations .
|
-
- HY-P10428
-
|
HPV
|
Infection
|
E6AP-mimicking peptide (compound 13) is a high-affinity, selective, irreversible and potent peptide-based covalent HPV16 E6 inhibitor targeting the 16E6 oncoprotein using a cysteine-reactive acrylamide warhead. E6AP-mimicking peptide has a Ki of 17 nM. E6AP-mimicking peptide targets all residues appearing in the binding pocket of E6 to disrupt the binding interface of 16E6 and E6AP. E6AP-mimicking peptide selectively binds and crosslinks to MBP-16E6 in PBS or a protein mixture .
|
-
- HY-P10626
-
NSPr
|
Peptides
|
Others
|
Nanodisc scaffold peptide (NSPr) is an amphipathic double-helical peptide that stabilizes membrane proteins by mimicking their natural environment, allowing them to remain stable and active in detergent-free aqueous solutions. Nanodisc scaffold peptide can be used to construct a universal tool for high-throughput stabilization of membrane proteins, facilitating modern biological research .
|
-
- HY-P5371
-
|
Thrombin
|
Others
|
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
|
-
- HY-P10356
-
|
Peptides
|
Others
|
T100-Mut is a cell-permeable peptide whose N-terminus is conjugated with a myristoylated group to enable T100-Mut to penetrate and localize to the inner side of the plasma membrane, thus mimicking the topology of Tmem100-3Q. T100-Mut can alleviate TRPA1-mediated pain .
|
-
- HY-N2466A
-
MT-I acetate; [Nle4,D-Phe7]-α-MSH acetate
|
Melanocortin Receptor
|
Cancer
|
Melanotan I acetate is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I acetate is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I acetate can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I acetate can be used for sunlight-induced skin cancers research .
|
-
- HY-P3431
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-N2466
-
MT-I; [Nle4,D-Phe7]-α-MSH
|
Melanocortin Receptor
|
Neurological Disease
Cancer
|
Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for the research of sun-induced skin cancer, melanoma, inflammation and male erectile dysfunction .
|
-
- HY-P3431A
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P10302
-
|
GLP Receptor
Insulin Receptor
|
Metabolic Disease
|
GLP-1R/GIPR AgonIST-1 is a double-receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulin releasing peptide). GLP-1R/GIPR agonist-1 lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
-
- HY-P10302A
-
|
GLP Receptor
|
Metabolic Disease
|
GLP-1R/GIPR agonist-1 soduim is the sodium salt form of GLP-1R/GIPR agonist-1 (HY-P10302). GLP-1R/GIPR agonist-1 soduim is a dual agonist for glucagon-like peptide-1 receptor (GLP-1R, EC50 is 0.57 nM) and glucose-dependent insulin releasing peptide receptor (GIPR, EC50 is 0.75 nM). GLP-1R/GIPR agonist-1 soduim lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 soduim can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
-
- HY-17551
-
-
-
- HY-N3021
-
|
Structural Classification
Natural Products
Classification of Application Fields
Source classification
Metabolic Disease
Endogenous metabolite
Disease Research Fields
|
Endogenous Metabolite
NF-κB
TNF Receptor
FOXO
Microtubule/Tubulin
|
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .
|
-
Cat. No. |
Product Name |
|
Classification |
-
- HY-W142596
-
|
|
Phospholipids
|
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .
|
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: