1. Search Result
Search Result
Results for "

mimicking

" in MedChemExpress (MCE) Product Catalog:

32

Inhibitors & Agonists

1

Fluorescent Dye

98

Biochemical Assay Reagents

15

Peptides

2

Natural
Products

1

Oligonucleotides

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-P5558

    VEGFR Inflammation/Immunology
    KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .
    KLTWQELYQLKYKGI
  • HY-P1416
    Foxy-5
    4 Publications Verification

    Wnt Cancer
    Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
    Foxy-5
  • HY-P1416A
    Foxy-5 TFA
    4 Publications Verification

    Wnt Cancer
    Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
    Foxy-5 TFA
  • HY-P0102

    mAChR Neurological Disease
    Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a mAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate can induce muscle relaxation .
    Dipeptide diaminobutyroyl benzylamide diacetate
  • HY-112416
    AZD4320
    1 Publications Verification

    Bcl-2 Family Cancer
    AZD4320 is a novel BH3-mimicking dual BCL2/BCLxL inhibitor with IC50s of 26 nM, 17 nM, and 170 nM for KPUM-MS3, KPUM-UH1, and STR-428 cells, respectively.
    AZD4320
  • HY-17551
    NMDA
    Maximum Cited Publications
    17 Publications Verification

    N-Methyl-D-aspartic acid

    iGluR Endogenous Metabolite Neurological Disease
    NMDA is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor.
    NMDA
  • HY-P10428

    HPV Infection
    E6AP-mimicking peptide (compound 13) is a high-affinity, selective, irreversible and potent peptide-based covalent HPV16 E6 inhibitor targeting the 16E6 oncoprotein using a cysteine-reactive acrylamide warhead. E6AP-mimicking peptide has a Ki of 17 nM. E6AP-mimicking peptide targets all residues appearing in the binding pocket of E6 to disrupt the binding interface of 16E6 and E6AP. E6AP-mimicking peptide selectively binds and crosslinks to MBP-16E6 in PBS or a protein mixture .
    E6AP-mimicking peptide
  • HY-W142596

    Liposome Others
    1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .
    1,2-DImyristoyl-rac-glycero-3-phosphocholine
  • HY-158463

    Others
    A2G2S2-KVANKT glycopeptide is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
    A2G2S2-KVANKT glycopeptide
  • HY-119274

    Others Neurological Disease
    BN-82451 dihydrochloride, an orally active and CNS-penetrated antioxidant and a multitargeting neuroprotective agent, exert a significant protection in experimental animal models mimicking aspects of cerebral ischemia, Parkinson disease, Huntington disease, and more particularly amyotrophic lateral sclerosis .
    BN-82451 dihydrochloride
  • HY-158516

    Mannose-6 N-linked oligosaccharide, procainamide labelled; Oligomannose 6 glycan, procainamide labelled

    Biochemical Assay Reagents Others
    M6 glycan (Man6), procainamide labelled (Mannose-6 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
    M6 glycan (Man6), procainamide labelled
  • HY-162467

    Others Others
    Opabactin is an agonist for abscisic acid (ABA) receptor, which regulates the water use of plants by mimicking the effects of ABA with an IC50 of 7 nM. Opabactin inhibits the seed germination of Arabidopsis with an IC50 of 62 nM. Opabactin induces anti-transpiration response in plant tissue, and improves crop drought tolerance .
    Opabactin
  • HY-B0867

    Others Others
    2,4-D Butyl ester is an organic phenoxy herbicide and used to control woody broad-leaf weeds. 2,4-D butyl ester produces its herbicidal effect by mimicking natural plant growth hormones causing plants to grow too rapidly to survive .
    2,4-D Butyl ester
  • HY-D2361

    Nucleoside Antimetabolite/Analog Others
    Adenosine 2'-PEG-Biotin is a biochemical reagent derived from adenosine. Adenosine 2'-PEG-Biotin regulates cell signaling pathways by mimicking the effects of endogenous adenosine and binding to its receptors. Adenosine 2'-PEG-Biotin can be used in the research of bioprobes, biosensors and diagnostic reagents .
    Adenosine 2'-PEG-Biotin
  • HY-P5371

    Thrombin Others
    TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
    TFLLRNPNDK-NH2
  • HY-134263

    PKA Ras Cardiovascular Disease
    8-Br-cAMP-AM is a cyclic adenosine monophosphate (cAMP) analog that activates two major signal transduction pathways in the heart by mimicking the effects of cAMP: protein kinase A (PKA) and guanosine nucleotide exchange factor (Epac), which is directly activated by cAMP. 8-Br-cAMP-AM can be used to study cardiac ischemia and reperfusion injury .
    8-Br-cAMP-AM
  • HY-126039

    Integrin Cardiovascular Disease
    L-739758 is an antagonist for αIIbβ3 integrin (platelet glycoprotein IIb/IIIa). L-739758 acts as a peptidomimetic, binds to αIIbβ3 integrin by mimicking the interaction of the RGD (arginine-glycine-aspartic acid) motif, and is involved in the blood coagulation process. L-739758 inhibits platelet aggregation, and is used for thrombosis research .
    L-739758
  • HY-126932

    Estrogen Receptor/ERR Cancer
    TTC-352 is an orally bioavailable selective human estrogen receptor (ER) α partial agonist (ShERPA). TTC-352 inhibits the growth of three TR ER+ breast cancer cell cultures in 3D. TTC-352 induces tumor regression accompanied by exit of ERα from the nucleus to extranuclear sites, mimicking the actions of E2 .
    TTC-352
  • HY-N2466A

    MT-I acetate; [Nle4,D-Phe7]-α-MSH acetate

    Melanocortin Receptor Cancer
    Melanotan I acetate is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I acetate is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I acetate can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I acetate can be used for sunlight-induced skin cancers research .
    Melanotan I acetate
  • HY-P3431

    iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-129242

    4-Oxo-Tempo

    Others Others
    Tempone (4-Oxo-Tempo) is a stable water-soluble nitro radical. Tempone is widely used as a contrast agent for metabolic activity and hypoxic sensitivity in electron spin resonance spectroscopy, magnetic resonance imaging and dynamic nuclear polarization. Tempone reduces superoxide radicals by mimicking the activity of superoxide dismutase (SOD), thereby reducing the formation of hydroxyl radicals and peroxynitrites. Tempone can be used in the study of ischemia-reperfusion injury and acute renal failure .
    Tempone
  • HY-116535B

    Parasite Infection
    DL-threo-PPMP is an inhibitor of sphingosine synthetase in Plasmodium falciparum. DL-threo-PPMP inhibits the activity of sphingosine synthetase by mimicking the substrate sphingosine. This inhibition leads to a rapid decrease in the activity of sensitive sphingosine synthetase, selectively destroying the interconnected tubular network of TVMs in the host cell cytoplasm, and this inhibition also blocks the proliferation of Plasmodium falciparum. DL-threo-PPMP can be used for the study of Plasmodium biology and the search for new antimalarial strategies .
    DL-threo-PPMP
  • HY-B0867R

    Others Others
    2,4-D Butyl ester (Standard) is the analytical standard of 2,4-D Butyl ester. This product is intended for research and analytical applications. 2,4-D Butyl ester is an organic phenoxy herbicide and used to control woody broad-leaf weeds. 2,4-D butyl ester produces its herbicidal effect by mimicking natural plant growth hormones causing plants to grow too rapidly to survive .
    2,4-D Butyl ester (Standard)
  • HY-N2466
    Melanotan I
    1 Publications Verification

    MT-I; [Nle4,D-Phe7]-α-MSH

    Melanocortin Receptor Neurological Disease Cancer
    Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for the research of sun-induced skin cancer, melanoma, inflammation and male erectile dysfunction .
    Melanotan I
  • HY-P3431A

    iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
  • HY-116945

    Endogenous Metabolite Others
    Diphenamid is a chemical compound that exhibits herbicide activity. Diphenamid acts by inhibiting the enzyme acetyl-CoA carboxylase. Diphenamid has shown resistance as a model for mimicking organic pollutants in wastewater treatment processes, especially in the presence of multiple anions. The degradation of diphenamid is significantly affected by certain inorganic ions, such as chromium (VI) and nitrogen oxides. Diphenamid shows changes in toxicity with longer treatment times, and the results of toxicity tests on selected algae indicate higher toxicity at 240 minutes of treatment .
    Diphenamid
  • HY-130495

    CDDO-Trifluoethyl amide; RTA 404; TP-500

    Keap1-Nrf2 Apoptosis Cancer
    CDDO-TFEA (RTA 404; TP-500) is a trifluoroacetamide derivative of CDDO with enhanced ability to cross the blood-brain barrier. CDDO is an Nrf2 activator that inhibits proliferation and induces differentiation and apoptosis in various cancer cells. CDDO-TFEA can enhance Nrf2 expression and signaling in various neurodegenerative disease models, including those mimicking multiple sclerosis, amyotrophic lateral sclerosis, and Huntington's disease. CDDO-TFEA induces apoptosis and blocks colony formation in Ewing's sarcoma and neuroblastoma cell lines with IC50 values ranging from 85-170 nM.
    CDDO-TFEA
  • HY-P10302

    GLP Receptor Insulin Receptor Metabolic Disease
    GLP-1R/GIPR AgonIST-1 is a double-receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulin releasing peptide). GLP-1R/GIPR agonist-1 lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
    GLP-1R/GIPR agonist-1
  • HY-131614
    TPC2-A1-N
    3 Publications Verification

    Calcium Channel Others
    TPC2-A1-N is a powerful and Ca 2+-permeable agonist of two pore channel 2 (TPC2), which plays its role by mimicking the physiological actions of NAADP. TPC2-A1-P reproducibly evokes significant Ca 2+ responses from TPC2 (EC50=7.8 μM), and the effect can be blocked by several TPC blockers. TPC2-A1-N can be used to probe different functions of TPC2 channels in intact cells .
    TPC2-A1-N
  • HY-N3021

    Endogenous Metabolite NF-κB TNF Receptor FOXO Microtubule/Tubulin Metabolic Disease
    D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .
    D-chiro-Inositol
  • HY-131615
    TPC2-A1-P
    2 Publications Verification

    Sodium Channel Others
    TPC2-A1-P is a powerful and membrane permeable agonist of two pore channel 2 (TPC2) with an EC50 of 10.5 μM. TPC2-A1-P plays its role by mimicking the physiological actions of PI(3,5)P2. TPC2-A1-P also shows higher potency to induce Na 2+ mobilisation from TPC2 than TPC-A1-N (HY-131614). TPC2-A1-P can be used to probe different functions of TPC2 channels in intact cells .
    TPC2-A1-P
  • HY-P10302A

    GLP Receptor Metabolic Disease
    GLP-1R/GIPR agonist-1 soduim is the sodium salt form of GLP-1R/GIPR agonist-1 (HY-P10302). GLP-1R/GIPR agonist-1 soduim is a dual agonist for glucagon-like peptide-1 receptor (GLP-1R, EC50 is 0.57 nM) and glucose-dependent insulin releasing peptide receptor (GIPR, EC50 is 0.75 nM). GLP-1R/GIPR agonist-1 soduim lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 soduim can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
    GLP-1R/GIPR agonist-1 (soduim)

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: