1. Vitamin D Related/Nuclear Receptor
  2. Thyroid Hormone Receptor
  3. Parathyroid hormone (1-34) (rat)

Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Parathyroid hormone (1-34) (rat) Chemical Structure

Parathyroid hormone (1-34) (rat) Chemical Structure

CAS No. : 98614-76-7

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Parathyroid hormone (1-34) (rat):

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Parathyroid hormone (1-34) (rat)

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis[1][2].

In Vivo

Parathyroid hormone (1-34) (rat) (s.c; 40 mg/kg; per day; for 4 weeks) promotes the formation of bone[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: ovariectomized (Ovx) rats[1]
Dosage: 40 mg/kg
Administration: s.c, per day, for 4 weeks
Result: Preserved Cn-BV/TV and trabecular connectivity, and combined estrogen and PTH caused a 40% increment in Cn-BV/TV while maintaining comparable trabecular connectivity with that seen in the Shamoperated animals.
Prevented further loss of connectivity and Cn-BV/TV, and combined estrogen and PTH resulted in as much as a 300% improvement in one of the parameters of trabecular connectivity, node to node strut length, and a 106% increase in Cn-BV/TV, with respect to the bone status at the initiation of treatment.
Molecular Weight

4057.71

Formula

C180H291N55O48S2

CAS No.
Appearance

Solid

Color

White to light yellow

Sequence

Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe

Sequence Shortening

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (24.64 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2464 mL 1.2322 mL 2.4644 mL
5 mM 0.0493 mL 0.2464 mL 0.4929 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2464 mL 1.2322 mL 2.4644 mL 6.1611 mL
5 mM 0.0493 mL 0.2464 mL 0.4929 mL 1.2322 mL
10 mM 0.0246 mL 0.1232 mL 0.2464 mL 0.6161 mL
15 mM 0.0164 mL 0.0821 mL 0.1643 mL 0.4107 mL
20 mM 0.0123 mL 0.0616 mL 0.1232 mL 0.3081 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Parathyroid hormone (1-34) (rat)
Cat. No.:
HY-P2279
Quantity:
MCE Japan Authorized Agent: