Parathyroid hormone (1-34) (rat) acetate

Name: Parathyroid hormone (1-34) (rat) acetate
Brand: MedChemExpress
SKU: HY-P2279A
Rating: 4.5 (1 reviews)

Cat. No.: HY-P2279A Purity: 99.87%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Parathyroid hormone (1-34) (rat) (acetate) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Parathyroid hormone (1-34) (rat) acetate Chemical Structure

Size	Price	Stock	Quantity
1 mg	USD 320	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 900	In-stock	Estimated Time of Arrival: December 31
10 mg	USD 1450	In-stock	Estimated Time of Arrival: December 31
50 mg		Get quote
100 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Parathyroid hormone (1-34) (rat) acetate:

Parathyroid hormone (1-34) (rat) Get quote

1 Publications Citing Use of MCE Parathyroid hormone (1-34) (rat) acetate

•Am J Stem Cells. 2023 Oct 20.

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vivo

Parathyroid hormone (1-34) (rat) (acetate) (s.c; 40 mg/kg; per day; for 4 weeks) promotes the formation of bone^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	ovariectomized (Ovx) rats^[1]
Dosage:	40 mg/kg
Administration:	s.c, per day, for 4 weeks
Result:	Preserved Cn-BV/TV and trabecular connectivity, and combined estrogen and PTH caused a 40% increment in Cn-BV/TV while maintaining comparable trabecular connectivity with that seen in the Shamoperated animals. Prevented further loss of connectivity and Cn-BV/TV, and combined estrogen and PTH resulted in as much as a 300% improvement in one of the parameters of trabecular connectivity, node to node strut length, and a 106% increase in Cn-BV/TV, with respect to the bone status at the initiation of treatment.

Molecular Weight

4117.76

Formula

C₁₈₂H₂₉₅N₅₅O₅₀S₂

Appearance

Solid

Color

White to off-white

Sequence

Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe

Sequence Shortening

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility

In Vitro:

H₂O : ≥ 100 mg/mL (24.29 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2429 mL	1.2143 mL	2.4285 mL
5 mM	0.0486 mL	0.2429 mL	0.4857 mL
10 mM	0.0243 mL	0.1214 mL	0.2429 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 99.87%

Select Batch:

Data Sheet (271 KB) SDS (252 KB)

COA (243 KB) LCMS (105 KB)

Handling Instructions (2659 KB)

References

[1]. V Shen, et al. Loss of cancellous bone mass and connectivity in ovariectomized rats can be restored by combined treatment with parathyroid hormone and estradiol. J Clin Invest. 1993 Jun;91(6):2479-87. [Content Brief]

[2]. Yebin Jiang, et al. Recombinant human parathyroid hormone (1-34) [teriparatide] improves both cortical and cancellous bone structure. J Bone Miner Res. 2003 Nov;18(11):1932-41. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.2429 mL	1.2143 mL	2.4285 mL	6.0713 mL
	5 mM	0.0486 mL	0.2429 mL	0.4857 mL	1.2143 mL
	10 mM	0.0243 mL	0.1214 mL	0.2429 mL	0.6071 mL
	15 mM	0.0162 mL	0.0810 mL	0.1619 mL	0.4048 mL
	20 mM	0.0121 mL	0.0607 mL	0.1214 mL	0.3036 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.