ACBD7 Protein, Human (His)

ACBD7 Protein, pivotal in cellular metabolism, exhibits specific binding to medium- and long-chain acyl-CoA esters, hinting at a role as a molecular carrier for intracellular transport. This unique capability suggests ACBD7's involvement in regulating lipid metabolism, emphasizing its potential impact on cellular processes related to lipid homeostasis and energy metabolism. ACBD7 Protein, Human (His) is the recombinant human-derived ACBD7 protein, expressed by E. coli , with N-His labeled tag. The total length of ACBD7 Protein, Human (His) is 88 a.a., with molecular weight of ~10 kDa.

The ACBD7 Protein plays a pivotal role in cellular metabolism by binding with specificity to medium- and long-chain acyl-CoA esters. This unique capability suggests that ACBD7 may function as a molecular carrier for these acyl-CoA species, contributing to the intracellular transport and regulation of lipid metabolism. The selective binding of ACBD7 to acyl-CoA esters underscores its potential involvement in various cellular processes related to lipid homeostasis and energy metabolism.

Human

E. coli

N-His

Q8N6N7 (M1-I88)

414149  [NCBI]

MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI

Approximately 10 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.