1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1
  5. IL-1 alpha
  6. Animal-Free IL-1 alpha/IL-1F1 Protein, Pig (His)

Animal-Free IL-1 alpha/IL-1F1 Protein, Pig (His)

Cat. No.: HY-P700242AF
Handling Instructions Technical Support

The IL-1α/IL-1F1 protein is found intracellularly in most non-hematopoietic cells and plays a crucial role in mediating inflammation and linking innate and adaptive immunity. IL1RAP binds to IL1R1 to form a high-affinity receptor complex that activates cascades and pathways. Animal-Free IL-1 alpha/IL-1F1 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-1 alpha/IL-1F1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-1 alpha/IL-1F1 Protein, Pig (His) is 158 a.a., with molecular weight of ~19.02 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-1α/IL-1F1 protein is found intracellularly in most non-hematopoietic cells and plays a crucial role in mediating inflammation and linking innate and adaptive immunity. IL1RAP binds to IL1R1 to form a high-affinity receptor complex that activates cascades and pathways. Animal-Free IL-1 alpha/IL-1F1 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-1 alpha/IL-1F1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-1 alpha/IL-1F1 Protein, Pig (His) is 158 a.a., with molecular weight of ~19.02 kDa.This product is for cell culture use only.

Background

The cytokine interleukin-1 alpha (IL-1 alpha), constitutively present intracellularly in almost all quiescent non-hematopoietic cells, plays a crucial role in inflammation and serves as a key mediator bridging the innate and adaptive immune systems. Upon binding to its receptor IL1R1, along with its accessory protein IL1RAP, IL-1 alpha forms the high-affinity interleukin-1 receptor complex, initiating signaling cascades involving the recruitment of adapter molecules such as MYD88, IRAK1, or IRAK4. This activation leads to the subsequent activation of NF-kappa-B and the three MAPK pathways—p38, p42/p44, and JNK pathways. Intracellularly, IL-1 alpha acts as an alarmin, and its release into the extracellular space upon cell death, following cell membrane disruption, induces inflammation and signals the host response to injury or damage. In addition to its role as a danger signal during cell necrosis, IL-1 alpha directly senses DNA damage, serving as a signal for genotoxic stress without compromising cell integrity. As a monomer, IL-1 alpha interacts with TMED10, facilitating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Furthermore, IL-1 alpha interacts with IL1R1 and S100A13, with the latter interaction being the initial step in the export of IL-1 alpha, followed by the direct translocation of this complex across the plasma membrane.

Species

Pig

Source

E. coli

Tag

C-His

Accession

P18430 (S113-S270)

Gene ID
Molecular Construction
N-term
IL-1α (S113-S270)
Accession # P18430
His
C-term
Synonyms
Interleukin-1 alpha; IL1A; IL-1 alpha; Interleukin 1 alpha
AA Sequence

MSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS

Molecular Weight

Approximately 19.02 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-1 alpha/IL-1F1 Protein, Pig (His)
Cat. No.:
HY-P700242AF
Quantity:
MCE Japan Authorized Agent: