1. Recombinant Proteins
  2. Others
  3. EIF4EBP2 Protein, Human (His)

EIF4EBP2 is a translation initiation repressor protein that plays a critical regulatory role in synaptic plasticity, learning, and memory. In the hypophosphorylated state, EIF4EBP2 competes with EIF4G1/EIF4G3, forms a complex with EIF4E, and inhibits translation. EIF4EBP2 Protein, Human (His) is the recombinant human-derived EIF4EBP2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF4EBP2 Protein, Human (His) is 120 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EIF4EBP2 is a translation initiation repressor protein that plays a critical regulatory role in synaptic plasticity, learning, and memory. In the hypophosphorylated state, EIF4EBP2 competes with EIF4G1/EIF4G3, forms a complex with EIF4E, and inhibits translation. EIF4EBP2 Protein, Human (His) is the recombinant human-derived EIF4EBP2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF4EBP2 Protein, Human (His) is 120 a.a., with molecular weight of ~17.0 kDa.

Background

EIF4EBP2, a repressor of translation initiation, plays a pivotal role in synaptic plasticity, learning, and memory formation. Acting as a key regulator of EIF4E activity, the hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3, forming a robust complex with EIF4E, thereby repressing translation. In contrast, the hyperphosphorylated form dissociates from EIF4E, enabling the interaction between EIF4G1/EIF4G3 and EIF4E, ultimately initiating translation. Enriched in the brain, EIF4EBP2 acts as a critical modulator of synapse activity and neuronal stem cell renewal, contributing to the regulation of protein translation in response to various signaling pathways, including MAP kinase and mTORC1. The intricate interplay between phosphorylation events and protein interactions underscores EIF4EBP2's multifaceted role in orchestrating cellular responses to external stimuli.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q13542 (M1-I120)

Gene ID
Molecular Construction
N-term
6*His
EIF4EBP2 (M1-I120)
Accession # Q13542
C-term
Synonyms
rHuEukaryotic translation initiation factor 4E-binding protein 2/EIF4EBP2, His; Eukaryotic Translation Initiation Factor 4E-Binding Protein 2; 4E-BP2; eIF4E-Binding Protein 2; EIF4EBP2
AA Sequence

MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 .

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

EIF4EBP2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EIF4EBP2 Protein, Human (His)
Cat. No.:
HY-P70416
Quantity:
MCE Japan Authorized Agent: