1. GPCR/G Protein
  2. GCGR
  3. GLP-1(7-36), amide TFA

GLP-1(7-36), amide TFA  (Synonyms: Glucagon-like peptide-1 (GLP-1)(7-36), amide TFA; Human GLP-1 (7-36), amide TFA)

Cat. No.: HY-P0054B Purity: 98.66%
COA Handling Instructions

GLP-1(7-36), amide TFA is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

For research use only. We do not sell to patients.

GLP-1(7-36), amide TFA Chemical Structure

GLP-1(7-36), amide TFA Chemical Structure

Size Price Stock Quantity
500 μg USD 144 In-stock
1 mg USD 240 In-stock
5 mg USD 720 In-stock
10 mg USD 1140 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 7 publication(s) in Google Scholar

Other Forms of GLP-1(7-36), amide TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GLP-1(7-36), amide TFA is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells[1].

In Vitro

Cells treated with phorbol 12-myristate 13-acetate for 2 h has significantly higher active GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate) concentrations in the media than those in the control. The glucose treatment also increases active GLP-1 secretion from cells in dose-dependent manner. Palmitic, oleic, linoleic or linolenic acid dose-dependently stimulated active GLP-1 secretion from cells. Active GLP-1 secretion is significantly greater with unsaturated fatty acids such as oleic, linoleic and linolenic acids than with palmitic acid. The treatment of NCI-H716 cells with CPE dose-dependently increases active GLP-1 concentrations in the media. A 37% increase is observed in active GLP-1 secretion from these cells at a concentration of 0.1 % CPE[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Gastric administration of glucose increases active GLP-1(7-36) amide levels in the portal blood after 10 min, followed by a marked decrease at 30 min. The gastric administration of TO also increases active GLP-1 levels after 10 min, and followed by a decrease to basal levels at 60 min. Individually, glucose and TO increase the secretion of GLP-1 in a dose-dependent manner. Furthermore, the co-administration of glucose and TO additively increase peak GLP-1 levels. CPE-administered mice have higher active GLP-1 levels in the portal blood at 10 and 30 min than those in the control mice. When glucose is administered with CPE, active GLP-1 and insulin levels in the portal blood are slightly higher in CPE-administered mice than in the control mice. High-fat diet-fed C57BL/6J mice develop hyperglycaemia and impair glucose tolerance[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3411.65

Formula

C151H227F3N40O47

Appearance

Solid

Color

White to off-white

Sequence Shortening

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRNH2

SMILES

[HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (TFA salt)]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : ≥ 50 mg/mL (14.66 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : < 0.1 mg/mL (insoluble)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2931 mL 1.4656 mL 2.9311 mL
5 mM 0.0586 mL 0.2931 mL 0.5862 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo:

Select the appropriate dissolution method based on your experimental animal and administration route.

For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for in vivo experiments, it is recommended to prepare freshly and use it on the same day.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

  • Protocol 1

    Add each solvent one by one:  10% DMSO    40% PEG300    5% Tween-80    45% Saline

    Solubility: ≥ 1.25 mg/mL (0.37 mM); Clear solution

    This protocol yields a clear solution of ≥ 1.25 mg/mL (saturation unknown).

    Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (12.5 mg/mL) to 400 μL PEG300, and mix evenly; then add 50 μL Tween-80 and mix evenly; then add 450 μL Saline to adjust the volume to 1 mL.

    Preparation of Saline: Dissolve 0.9 g sodium chloride in ddH₂O and dilute to 100 mL to obtain a clear Saline solution.
  • Protocol 2

    Add each solvent one by one:  10% DMSO    90% (20% SBE-β-CD in Saline)

    Solubility: ≥ 1.25 mg/mL (0.37 mM); Clear solution

    This protocol yields a clear solution of ≥ 1.25 mg/mL (saturation unknown).

    Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (12.5 mg/mL) to 900 μL 20% SBE-β-CD in Saline, and mix evenly.

    Preparation of 20% SBE-β-CD in Saline (4°C, storage for one week): 2 g SBE-β-CD powder is dissolved in 10 mL Saline, completely dissolve until clear.
In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Please enter your animal formula composition:
%
DMSO +
+
%
Tween-80 +
%
Saline
Recommended: Keep the proportion of DMSO in working solution below 2% if your animal is weak.
The co-solvents required include: DMSO, . All of co-solvents are available by MedChemExpress (MCE). , Tween 80. All of co-solvents are available by MedChemExpress (MCE).
Calculation results:
Working solution concentration: mg/mL
Method for preparing stock solution: mg drug dissolved in μL  DMSO (Stock solution concentration: mg/mL).

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only. If necessary, please contact MedChemExpress (MCE).
Method for preparing in vivo working solution for animal experiments: Take μL DMSO stock solution, add μL . μL , mix evenly, next add μL Tween 80, mix evenly, then add μL Saline.
 If the continuous dosing period exceeds half a month, please choose this protocol carefully.
Please ensure that the stock solution in the first step is dissolved to a clear state, and add co-solvents in sequence. You can use ultrasonic heating (ultrasonic cleaner, recommended frequency 20-40 kHz), vortexing, etc. to assist dissolution.
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2931 mL 1.4656 mL 2.9311 mL 7.3278 mL
5 mM 0.0586 mL 0.2931 mL 0.5862 mL 1.4656 mL
10 mM 0.0293 mL 0.1466 mL 0.2931 mL 0.7328 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-1(7-36), amide TFA
Cat. No.:
HY-P0054B
Quantity:
MCE Japan Authorized Agent: