1. GPCR/G Protein
  2. GCGR
  3. GLP-1(7-36), amide acetate

GLP-1(7-36), amide acetate  (Synonyms: Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate)

Cat. No.: HY-P0054 Purity: 99.36%
SDS COA Handling Instructions

GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-1(7-36), amide acetate Chemical Structure

GLP-1(7-36), amide acetate Chemical Structure

CAS No. : 1119517-19-9

Size Price Stock Quantity
500 μg USD 144 In-stock
1 mg USD 240 In-stock
5 mg USD 720 In-stock
10 mg USD 1140 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 7 publication(s) in Google Scholar

Other Forms of GLP-1(7-36), amide acetate:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

In Vitro

Cells treated with phorbol 12-myristate 13-acetate for 2 h has significantly higher active GLP-1(7-36), amide acetate concentrations in the media than those in the control. The glucose treatment also increases active GLP-1 secretion from cells in dose-dependent manner. Palmitic, oleic, linoleic or linolenic acid dose-dependently stimulated active GLP-1 secretion from cells. Active GLP-1 secretion is significantly greater with unsaturated fatty acids such as oleic, linoleic and linolenic acids than with palmitic acid. The treatment of NCI-H716 cells with CPE dose-dependently increases active GLP-1 concentrations in the media. A 37% increase is observed in active GLP-1 secretion from these cells at a concentration of 0.1 % CPE[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Gastric administration of glucose increases active GLP-1(7-36) amide levels in the portal blood after 10 min, followed by a marked decrease at 30 min. The gastric administration of TO also increases active GLP-1 levels after 10 min, and followed by a decrease to basal levels at 60 min. Individually, glucose and TO increase the secretion of GLP-1 in a dose-dependent manner. Furthermore, the co-administration of glucose and TO additively increase peak GLP-1 levels. CPE-administered mice have higher active GLP-1 levels in the portal blood at 10 and 30 min than those in the control mice. When glucose is administered with CPE, active GLP-1 and insulin levels in the portal blood are slightly higher in CPE-administered mice than in the control mice. High-fat diet-fed C57BL/6J mice develop hyperglycaemia and impair glucose tolerance[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3297.64 (free base)

Formula

C149H226N40O45.xC2H4O2

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Sequence Shortening

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRNH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

H2O : ≥ 100 mg/mL

*"≥" means soluble, but saturation unknown.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo:

For the following dissolution methods, please prepare the working solution directly. It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

  • Protocol 1

    Add each solvent one by one:  PBS

    Solubility: 25 mg/mL; Clear solution; Need ultrasonic

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-1(7-36), amide acetate
Cat. No.:
HY-P0054
Quantity:
MCE Japan Authorized Agent: