Search Result

Results for "

Lewis

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Antibiotic (2) Apoptosis (6) Bcl-2 Family (2) Biochemical Assay Reagents (4) c-Fms (1) Caspase (2) CCR (2) DNA/RNA Synthesis (1) Dopamine Transporter (1) Endogenous Metabolite (7) FAK (1) Fluorescent Dye (2) Fungal (1) Glucocorticoid Receptor (1) HCV (2) HIV (1) HSP (1) HSV (1) Interleukin Related (1) MMP (1) NO Synthase (1) PAI-1 (1) Parasite (1) PARP (1) PD-1/PD-L1 (1) PDGFR (2) PDHK (1) PI3K (1) Prostaglandin Receptor (2) Sialyltransferase (1) Syk (1) Toll-like Receptor (TLR) (2) Topoisomerase (1) VEGFR (2)
By Research Areas:	Cancer (33) Cardiovascular Disease (5) Endocrinology (1) Infection (7) Inflammation/Immunology (14) Metabolic Disease (3) Neurological Disease (1)
Oligonucleotides:	Aptamers (2) CpG ODNs (2)

Inhibitors & Agonists

Fluorescent Dye

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

Natural
Products

Oligonucleotides

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-N10535

Lewis y tetrasaccharide Lewis y	FAK	Cancer
Lewis Y tetrasaccharide (Lewis Y, Le ^Y) is a tetrasaccharide derivative form of Lewis X trisaccharide (HY-N10534). Lewis Y tetrasaccharide is an antigen associated with malignant ovarian carcinomas metastasis and poor prognosis .

HY-W020790

*Sialyl-Lewis* X** sLeX	Endogenous Metabolite	Inflammation/Immunology
Sialyl-Lewis X (sLeX) is a sialylated fucosylated tetrasaccharide, an endogenous antigen. Sialyl-Lewis X is a high-affinity ligand for selectins (E-, P-, and L-selectin) . Sialyl-Lewis X binds to ELAM-1 and CD62 and has the ability?to inhibits CD62-mediated neutrophil recruitment to sites of inflammation .

HY-N10531

Lewis a trisaccharide Lewis a	Others	Others
Lewis a trisaccharide (Lewis a) is a trisaccharide that has been found to be present in the glycan structures of spermatozoa. Lewis a trisaccharide also is a major component of the glycan structures on the surface of HL-60 cells .

HY-N10534

Lewis X trisaccharide Lewis X	Parasite	Infection Inflammation/Immunology Cancer
Lewis X trisaccharide (Lewis X, Le ^x) is a potent T_H2 regulator, antagonizes LPS-induced IL-12 immune expression. Lewis X trisaccharide is a human histo-blood group antigen, plays an key role in cell-cell adhesion, and servers as a tumor marker. Lewis X trisaccharide is highly expressed in the outer membrane of the parasite, can be used for the immunology research of schistosomiasis .

HY-N12918

Lewis X tetrasaccharide	Others	Infection
Lewis X tetrasaccharide is a cell surface glycan that can be used for diagnosis of microbial infections.

HY-W854445

Lewis-b tetrasaccharide	Biochemical Assay Reagents	Others
Lewis-b tetrasaccharide is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology .

HY-W698344

Lewis X Trisaccharide,Methyl Glycoside	Biochemical Assay Reagents	Others
Lewis X Trisaccharide,Methyl Glycoside is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology .

HY-W854385

*Sialyl Lewis* A** SLeA	Others	Cancer
Sialyl Lewis A (SLeA) is a carbohydrate-type antigen that can serve as a tumor marker, with upregulation observed in various tumor cells such as cervical cancer, human pancreatic cancer, and colon cancer cells. Sialyl Lewis A is involved in the migration and adhesion of tumor cells. Additionally, elevated expression of Sialyl Lewis A may also lead to pregnancy abnormalities .

HY-W145535

*Sialyl lewis* x-lactose**	Biochemical Assay Reagents Endogenous Metabolite	Others
Sialyl Lewis X-Lactose is a biochemical reagent that can be used as a biological material or organic compound for life science related research.

HY-W142631

4-(Phenylazo)diphenylamine	Fluorescent Dye	Cancer
4-(Phenylazo)diphenylamine is an excellent colorimetric indicator for the accurate determination of the concentration for a variety of strong bases, Lewis acids, and hydride reducing agents .

HY-19015

Probimane AT-2153	Others	Cancer
Probimane (AT-2153) is a potent anticancer agent. Probimane is effective against mouse tumors S37, S180, Lewis lung carcinoma, L1210 and human pulmonary adenocarcinoma heterotransplanted into nude mice .

HY-110288

3FAx-Neu5Ac	Sialyltransferase	Metabolic Disease
3FAx-Neu5Ac (compound 8), a Sialic acid peracetylated analog, is a sialyltransferase inhibitor. 3FAx-Neu5Ac substantially reduces expression of the sialylated ligand sialyl Lewis X on myeloid cells .

HY-E70059

alpha-1,2-Fucosyltransferase (α1,2FucT)	Others	Cancer
alpha-1,2-Fucosyltransferase (α1,2FucT), i.e., alpha 1, 2-fucosyltransferase, is often used in biochemical studies. alpha-1,2-Fucosyltransferase is a rate-limiting enzyme, can catalyze the synthesis of Lewis y (a cell membrane-associated carbohydrate antigen) .

HY-162863

ERK-MYD88 interaction inhibitor 1	Apoptosis	Cancer
ERK-MYD88 interaction inhibitor 1 is an ERK-MYD88 interaction inhibitor. ERK-MYD88 interaction inhibitor 1 can induce an HRI-mediated integrated stress response (ISR), leading to cancer cell-specific immunogenic cell apoptosis (apoptosis). ERK-MYD88 interaction inhibitor 1 can induce anti-tumor T cell responses in Lewis lung cancer mice, exhibiting anti-tumor activity .

HY-N7575

Lacto-N-fucopentaose II LNFP II	Endogenous Metabolite	Metabolic Disease
Lacto-N-fucopentaose II (LNFP II) is a sialyl-Lewis, hapten of human Lewis bloodgroup determinant. Lacto-N-fucopentaose II monosialo-ganglioside/glycolipid and sialyl derivative, CA 19-9, is a molecular tumour markers (TM) for biliopancreatic malignancy .

HY-N11455

Lacto-N-difucohexaose I LDFH I	Others	Metabolic Disease
Lacto-N-difucohexaose I (LNDFH I), a linker, could be used to combine oligosaccharides containing Lewis b sugar chain to water insoluble polysaccharide .

HY-E70303

Fucosyltransferase 6 FUT6	Endogenous Metabolite	Cancer
Fucosyltransferase 6 is a fucosyltransferase that mediates the expression of the tetrasaccharide Sialyl-Lewis x (sLex, CD15s) on the surface of leukocytes. sLex participates in E-selectin-mediated leukocyte rolling and is related to the migration of leukocytes out of blood vessels .

HY-126854

N-Acetyllactosamine N-Acetyl-D-lactosamine	Endogenous Metabolite	Others
N-Acetyllactosamine (LacNAc), a nitrogen-containing disaccharide, is an important component of various oligosaccharides such as glycoproteins and sialyl Lewis X. N-Acetyllactosamine can be used as the starting material for the synthesis of various oligosaccharides. N-Acetyllactosamine has prebiotic effects .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-P4191A

Met-RANTES (human) (acetate)	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-125443

Lucialdehyde A	Others	Cancer
Lucialdehydes A is a lanostante-type triterpene aldehydes, isolated from the fruiting bodies of Ganoderma lucidum. Lucialdehydes A shows cytotoxic effects on tumor cells, including Lewis lung carcinoma (LLC), T-47D, Sarcoma 180, and Meth-A tumor cell lines .

HY-125664

Lucialdehyde B	Antibiotic	Cancer
Lucialdehyde B is a tetracyclic triterpene isolated from the substrates of Ganoderma lucidum with antiviral and cytotoxic activities. Lucialdehyde B has cytotoxic effects against Lewis lung cancer (LLC), T-47D, Sarcoma 180 and Meth-A tumor cell lines .

HY-107055

RTI 336	Dopamine Transporter	Neurological Disease
RTI 336 is a phenyltropane analog, as well as a potent and selective dopamine transporter (DAT) inhibitor. RTI 336 inhibits addictive agent induced locomotor activity and self-administration in Lewis rats. RTI 336 exhibits inhibitory effects depending on inherent NAc DAT levels .

HY-W033277

Tetrakis(acetonitrile)palladium(II) tetrafluoroborate NSC 307191; Palladium(II) tetrafluoroborate tetraacetonitrile complex	Others	Others
Tetrakis(acetonitrile)palladium(II) tetrafluoroborate (NSC 307191) acts as a potent Lewis acid and facilitates the formation of the 2:1 complex [Pd(1,2-bis(2′-pyridylethynyl)benzene)2](BF4)2 through the Sonogashira cross-coupling reaction.

HY-122063

FR260330	NO Synthase	Inflammation/Immunology
FR260330 is a selective, orally active inhibitor for inducible nitric oxide synthase (iNOS) through suppression of iNOS dimerization. FR260330 inhibits the NO accumulation in rat splenocytes and human DLD-110 cells, with IC₅₀ of 27 and 10 nM. FR260330 ameliorates the Lipopolysaccharides (HY-D1056)-induced inflammatory diseases in rats model .

HY-116758

16,16-Dimethyl prostaglandin A1 di-Me-PGA1	DNA/RNA Synthesis HIV HSV	Infection Cancer
16,16-Dimethyl prostaglandin A1 (di-Me-PGA1) is a prostaglandin analog that can inhibit DNA synthesis in Lewis lung carcinoma and B 16 amelanotic melanoma cells. 16,16-Dimethyl prostaglandin A1 also inhibits viral replication in both HSV and HIV-1 infection systems .

HY-120638

BMS-250749	Topoisomerase	Cancer
BMS-250749 is a topoisomerase I (Top I) inhibitor of the fluoroglycosyl-3,9-difluoroindolecarbazole class. BMS-250749 exhibits potent cytotoxicity and selectivity, and shows curative antitumor activity against Lewis lung cancer. BMS-250749 exhibits broad-spectrum antitumor activity superior to CPT-11 in certain preclinical xenograft models. .

HY-118488

L 640035	Prostaglandin Receptor	Cardiovascular Disease
L 640035 is athromboxaneantagonist .

HY-123191

CJ-463	PAI-1	Cancer
CJ-463 is a potent and selective uPA inhibitor. CJ-463 has antitumor activity .

HY-119110

LY52	MMP	Cancer
LY52 is an MMP-2 and MMP-9 inhibitor. LY52 can significantly block the proteolytic activity of gelatinases, reducing the expression of MMP-2 and MMP-9 in SKOV3 cells, thereby inhibiting cell invasion. LY52 can also suppress the pulmonary metastasis of Lewis lung carcinoma cells in mice. LY52 may be used in cancer research .

HY-132202

PD-1/PD-L1-IN-10	PD-1/PD-L1 Apoptosis	Cancer
PD-1/PD-L1-IN-10 (compound B2) is an orally active PD-1/PD-L1 inhibitor (IC₅₀ of 2.7 nM) with potent anticancer efficacy .

HY-149814

PDK-IN-1	PDHK HSP	Cancer
PDK-IN-1 (compound 7o) is a pyruvate dehydrogenase kinase (PDK) inhibitor. PDK-IN-1 shows IC₅₀ values of 0.03 and 0.1 μM for PDK1 and HSP90, respectively. PDK-IN-1 targets PDH/PDK axis thus reducing efficiently the tumor mass .

HY-160048

PEG40K unconjugated/naked AX102 sodium	PDGFR	Cancer
PEG40K unconjugated/naked AX102 sodium is AX102 without PEG40K conjugation. AX102 is a DNA oligonucleotide aptamer for platelet-derived growth factor PDGF-B. AX102 is 34 bases in length, selectively binds platelet-derived growth factor B (PDGF-B), and causes tumor vessel regression .

HY-160047

AX102 sodium	PDGFR	Cancer
AX102 sodium is a 34 bp length nucleotide aptamer modified at the 5' end with a 40 kDa polyethylene glycol moiety. AX102 selectively binds platelet-derived growth factor B (PDGF-B) and causes tumor vessel regression .

HY-126740

Anguinomycin A	Antibiotic Fungal	Infection Cancer
Anguinomycin A is an antibiotic that exhibits good inhibitory activity against G. boninense with an MIC value of 5 µg/disk. Anguinomycin A has antitumor activity .

HY-E70284

Keratanase II,bacillus circulans,expressed in E.coli	Biochemical Assay Reagents	Others
Keratanase II,bacillus circulans,expressed in E.coli has transglycosylation activity. Keratanase II,bacillus circulans,expressed in E.coli efficiently catalyzes the transglycosylation of α(2→3)-sialylated 6,6′-di-sulfo-LacNAc with two kinds of glycosyl acceptors, 6-sulfo-Lewis X and 6,6'-di-sulfo-LacNAc derivatives, providing Sialyl sulfo-hexasaccharide and Sialyl sulfo-pentasaccharide .

HY-13718

Oglufanide H-Glu-Trp-OH; L-Glutamyl-L-tryptophan	VEGFR HCV Endogenous Metabolite	Infection Cardiovascular Disease Inflammation/Immunology Cancer
Oglufanide (H-Glu-Trp-OH) is a dipeptide immunomodulator isolated from calf thymus. Oglufanide inhibits vascular endothelial growth factor (VEGF). Oglufanide can stimulate the immune response to hepatitic C virus (HCV) and intracellular bacterial infections. Oglufanide shows antitumor and anti-angiogenesis activities .

HY-146245C

ODN 1826 sodium 2 Publications Verification CpG 1826 sodium	Toll-like Receptor (TLR) Apoptosis	Cardiovascular Disease Cancer
ODN 1826 sodium is a class B CpG ODN (oligodeoxynucleotide) that is a TLR9 agonist. ODN 1826 sodium is an immunostimulatory agent that induces NO and iNOS production in mouse models. ODN 1826 sodium also enhances apoptosis (apoptosis) and may promote atherosclerosis. ODN 1826 sequence: 5’-tccatgacgttcctgacgtt-3’ .

HY-13718A

Oglufanide disodium H-Glu-Trp-OH disodium; L-Glutamyl-L-tryptophan disodium	VEGFR HCV Endogenous Metabolite	Infection Cardiovascular Disease Inflammation/Immunology Cancer
Oglufanide (H-Glu-Trp-OH) disodium is a dipeptide immunomodulator isolated from calf thymus. Oglufanide disodium inhibits vascular endothelial growth factor (VEGF). Oglufanide disodium can stimulate the immune response to hepatitic C virus (HCV) and intracellular bacterial infections. Oglufanide disodium shows antitumor and anti-angiogenesis activities .

HY-163651

(R)-Vorbipiprant (R)-CR6086	Prostaglandin Receptor	Inflammation/Immunology
(R)-Vorbipiprant ((R)-CR6086) is an orally active antagonist for prostaglandin E2 receptor 4 (EP4) with K_i of 16.6 nM for human EP4. (R)-Vorbipiprant inhibits PGE2 (HY-101952)-induced cAMP production with an IC₅₀ of 22 nM. (R)-Vorbipiprant exhibits immunomodulatory and anti-angiogenic activities, and ameliorates the collagen-induced arthritis in mice .

HY-136198

SRX3207	Syk PI3K	Cancer
SRX3207 is an orally active and first-in-class dual Syk/PI3K inhibitor, with IC₅₀ values of 10.7 nM and 861 nM for Syk and PI3Kα, respectively. SRX3207 relieves tumor immunosuppression .

HY-13496

JNJ-28312141	c-Fms	Inflammation/Immunology Cancer
JNJ-28312141 is an inhibitor for colony-stimulating factor-1 receptor (CSF-1R or FMS), with an IC₅₀ of 0.69 nM. JNJ-28312141 inhibits proliferation of BDBM, MV-4-11, M-o7e, TF-1 with an IC₅₀s of 2.6, 21, 41 and 150 nM, respectively. JNJ-28312141 exhibits anti-inflammatory activity in mouse arthritis model .

HY-113462

α-Carotene	Others	Cancer
α-Carotene, a precursor of vitamin A, is used as an anti-metastatic agent or as an adjuvant for anti-cancer agents. α-Carotene is isolated from yellow-orange and dark-green vegetables .

HY-113462R

α-Carotene (Standard)	Others	Cancer
α-Carotene (Standard) is the analytical standard of α-Carotene. This product is intended for research and analytical applications. α-Carotene, a precursor of vitamin A, is used as an anti-metastatic agent or as an adjuvant for anti-cancer agents. α-Carotene is isolated from yellow-orange and dark-green vegetables .

HY-146245

ODN 1826 CpG 1826	Toll-like Receptor (TLR) Apoptosis	Inflammation/Immunology Cancer
ODN 1826 (CpG 1826), a class B CpG ODN (oligodeoxynucleotide), is a TLR9 agonist. ODN 1826 promotes Apoptosis. ODN 1826 is an excellent immune stimulator with antitumor activity. ODN 1826 has protective effects on the heart. ODN 1826 sequence: 5’-tccatgacgttcctgacgtt-3’ .

HY-108164

Aspidin BB	Apoptosis Bcl-2 Family Caspase	Cancer
Aspidin BB is a phloroglucinol derivative, which can be isolated from the aerial part of Dryopteris championii. Aspidin BB has anticancer activity. Aspidin BB induces cell cycle arrest and apoptosis in human ovarian HO-8910 cells .

HY-159803

IST-622 6-O-(3-Ethoxypropionyl)-3',4'-O-exo-benzylidenechartreusin	Others	Cancer
IST-622 (6-O-(3-Ethoxypropionyl)-3',4'-O-exo-benzylidenechartreusin) is an anti-tumor agent with significant growth inhibitory activity. IST-622 exhibits significant anti-tumor effects against a variety of mouse tumors such as P388 and L1210 leukemias, B16 melanoma, Lewis lung carcinoma, Colon 26 and Colon 38 adenocarcinomas, and M5076 reticulum cell sarcoma. IST-622 was orally administered and the results showed efficacy in different tumor types. In addition, IST-622 provided significant inhibitory effects against two human tumor xenograft models: large cell lung carcinoma (Lu-116) and gastric adenocarcinoma (St-4). IST-622 also exhibited significant growth inhibitory activity against P388 leukemia in vitro, with a half inhibitory concentration (IC50) more than 20 times lower than CT .

HY-B0328

Triamcinolone 2 Publications Verification	Glucocorticoid Receptor Interleukin Related	Inflammation/Immunology Endocrinology Cancer
Triamcinolone is a long-acting corticosteroid with anti-inflammatory, anti-oedematous, anti-proliferative, anti-angiogenetic, immunomodulatory and neuroprotective effects through binding to glucocorticoid receptors. Triamcinolone can relieve several dermatitis, immune diseases and ocular diseases .

HY-13594

Chlorin e6 Maximum Cited Publications 6 Publications Verification Ce6	Bcl-2 Family Caspase PARP Apoptosis Fluorescent Dye	Infection Cancer
Chlorin e6 is a photosensitizer and has strong absorption peaks at wavelength of 402 and 662 nm, as well as exhibiting intense fluorescence at 668 nm. Chlorin e6 has antimicrobial efficacy and anticancer activity. Chlorin e6 induces cell apoptosis via caspase-3 activation and can be used for the research of cancer .

HY-117019

LY150310 free base	Others	Cancer
LY150310 is able to inhibit thromboxane synthase, cyclooxygenase, and thrombin activation, biochemical processes that have been proposed in the literature as targets for anti-metastatic agents. The objectives of this study were twofold: (a) to compare the anti-metastatic activity of Eli Lilly compounds with reference anti-metastatic compounds nafazatrom and RA233; and (b) to examine the correlation between inhibition of spontaneous lung metastasis and survival. The anti-metastatic activity of the compounds was evaluated using the Lewis lung squamous cell carcinoma cell model. In this model, 5×10^5 tumor cells were implanted into the gastrocnemius muscle, the primary tumor was resected on day 14, and lung metastatic lesions were counted on day 25. The compounds were administered every 12 hours from day 5 to day 19. Nafazatrom, LY150310, LY189332, and LY135305 were found to inhibit spontaneous lung metastasis in a dose-dependent manner. The ED50 values ??of these compounds were 50, 0.5, 2, and 0.35 mg/kg/day, respectively; the corresponding therapeutic indices (LD50/ED50) were 7, 180, 255, and 511, respectively. To evaluate the effects of nafazatrom, LY150310, LY189332, and LY135305 on animal survival, these compounds were given at the maximum anti-metastatic dose of 200, 60, 20, and 6 mg/kg/day, respectively. Two dosing schedules were used: (a) from day 5 to 19; (b) from day 5 to death. These compounds did not significantly alter median survival times or the number of long-term survivors at any dosing schedule. RA233 did not inhibit lung metastasis or increase median survival time at a schedule in which the maximum tolerated dose of 200 mg/kg/day was given until death on day 5. Postmortem examination of animals given nafazatrom, LY150310, LY189332, and LY1350310 revealed complete suppression of lung lesions, whereas lesions developed in the liver, kidney, spleen, and brain. The results of this study suggest that the effects of a compound on the number of metastatic lesions in target organs may not be predictive of its effects on survival. To successfully translate laboratory data into clinical applications, survival should be considered a predictor of the potential clinical utility of a compound.

Cat. No.	Product Name	Type

HY-W142631

4-(Phenylazo)diphenylamine	Dyes
4-(Phenylazo)diphenylamine is an excellent colorimetric indicator for the accurate determination of the concentration for a variety of strong bases, Lewis acids, and hydride reducing agents .

Cat. No.	Product Name	Type

HY-W854445

Lewis-b tetrasaccharide

Carbohydrates

Lewis-b tetrasaccharide is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology .

HY-W698344

Lewis X Trisaccharide,Methyl Glycoside

Carbohydrates

Lewis X Trisaccharide,Methyl Glycoside is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology .

HY-W145535

*Sialyl lewis* x-lactose**	Biochemical Assay Reagents
Sialyl Lewis X-Lactose is a biochemical reagent that can be used as a biological material or organic compound for life science related research.

HY-E70158

Fucosyltransferase 9 EC:2.4.1.152; FUT9	Enzyme Substrates
Fucosyltransferase 9 (EC:2.4.1.152, FUT9) catalyzes the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. Fucosyltransferase 9 synthesizes the LeX oligosaccharide (CD15) .

HY-E70156

Fucosyltransferase 7 EC:2.4.1.-; FUT7	Enzyme Substrates
Fucosyltransferase 7 (FUT7) is a golgi stack membrane protein. Fucosyltransferase 7catalyzes the final fucosylation step in the synthesis of Lewis antigens and generates a unique glycosylated product sialyl Lewis X (sLeX). Fucosyltransferase 7 catalyzes alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens .

HY-158459

A2G2F2 glycan A2G2F2(a1-3) glycan	Carbohydrates
A2G2F2 glycan (A2G2F2(a1-3) glycan) is a Lewis X polysaccharide containing two Lewis X epitopes and is a symmetric N-glycan. SLeX is a ligand for the cell adhesion molecule E-selectin, which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .

HY-158457

A2[3]G1 N-glycan N/A	Carbohydrates
A2[3]G1 N-glycan (N/A) is a Lewis sugar. SLeX is a ligand for the cell adhesion molecule E-selectin, which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .

HY-158495

A2 glycan (G0), 2-AA labelled A2 N-linked oligosaccharide, 2-AA labelled	Carbohydrates
A2[3]G1 & A2[6]G1 glycan (G1), 2-AB labeled Lewis sugar. SLeX is a ligand for the cell adhesion molecule E-selectin (E-selectin), which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .

HY-158522

A2[3]G1 & A2[6]G1 glycan (G1), 2-AB labelled A2[3]G1 & A2[6]G1 N-linked oligosaccharide, 2-AB labelled	Carbohydrates
A2[3]G1 & A2[6]G1 glycan (G1), 2-AB labeled Lewis sugar. SLeX is a ligand for the cell adhesion molecule E-selectin (E-selectin), which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .

HY-158458

A2[3]G1F1(α-1-3) glycan A2[3]G1F1(a1-3) glycan	Carbohydrates
A2[3]G1F1(α-1-3) glycan (A2[3]G1F1(a1-3) glycan) is an asymmetric Lewis X polysaccharide and N-glycan. SLeX is a ligand for the cell adhesion molecule E-selectin, which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .

Cat. No.	Product Name	Target	Research Area

HY-12523

Peptide M	Peptides	Others
Peptide M is a synthetic amino acid (18 amino acids in length which correspond to the amino acid positions 303-322 of bovine S-antigen: DTNLASSTIIKEGIDKTV), is capable of inducing experimental autoimmune uveitis in monkeys and Hartley guinea pigs as well as Lewis rats .

HY-P2479

Peripheral Myelin Protein P2 (53-78), bovine	Peptides	Inflammation/Immunology
Peripheral Myelin Protein P2 (53-78), bovine is derived from bovine peripheral myelin P2 protein amino acid residues 53-78. Peripheral Myelin Protein P2 (53-78), bovine is a T cell epitope for the induction of experimental autoimmune neuritis (EAN) in Lewis rats .