2. GPCR/G Protein
  3. Angiotensin Receptor
  4. C-Type Natriuretic Peptide (1-53), human TFA

C-Type Natriuretic Peptide (1-53), human TFA 

Cat. No.: HY-P1815A Purity: 99.00%
SDS COA Handling Instructions

Molarity Calculator

C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

C-Type Natriuretic Peptide (1-53), human TFA Chemical Structure

C-Type Natriuretic Peptide (1-53), human TFA Chemical Structure

Size Price Stock Quantity
5 mg USD 590 In-stock
10 mg USD 950 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of C-Type Natriuretic Peptide (1-53), human TFA:

C-Type Natriuretic Peptide (1-53), human TFA Related Antibodies

Top Publications Citing Use of Products

View All Angiotensin Receptor Isoform Specific Products:

View All Isoforms
AT1 Receptor AT2 Receptor

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone[1].

Molecular Weight

5801.77 (free acid)

Formula

C251H417N81O71S3.xC2HF3O2
Appearance

Solid

Color

White to off-white

Sequence

Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge:Cys37-Cys55)
Sequence Shortening

DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

C-Type Natriuretic Peptide (1-53), human TFA Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

C-Type Natriuretic Peptide (1-53), humanAngiotensin ReceptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
C-Type Natriuretic Peptide (1-53), human TFA
Cat. No.:
HY-P1815A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.