1. Protein Tyrosine Kinase/RTK PI3K/Akt/mTOR
  2. Insulin Receptor Akt
  3. Insulin glargine

Insulin glargine is a long-acting insulin analog. Insulin glargine has the effect of lowering blood sugar and can be used in the research of diabetes. In addition, high doses of Insulin glargine can promote the proliferation of bladder cancer cells.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Insulin glargine Chemical Structure

Insulin glargine Chemical Structure

CAS No. : 160337-95-1

Size Price Stock Quantity
100 U In-stock
300 U In-stock

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Insulin glargine:

Top Publications Citing Use of Products

View All Akt Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Insulin glargine is a long-acting insulin analog. Insulin glargine has the effect of lowering blood sugar and can be used in the research of diabetes. In addition, high doses of Insulin glargine can promote the proliferation of bladder cancer cells[1][2][3][4].

In Vitro

Insulin glargine (10-100 IU/L; 0-72 h) activates Akt in a PI3K-independent manner, thereby promoting the proliferation of bladder cancer cells[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Viability Assay[1]

Cell Line: T24 bladder cancer cell
Concentration: 0.1, 1, 10 and 100 IU/L
Incubation Time: 72 h
Result: Promoted T24 cell proliferation at concentrations of 10 IU/L and 100 IU/L.
Did not affect cell proliferation at 0.1 IU/L and 1 IU/L.
In Vivo

Insulin glargine (2-12.5 IU/kg; subcutaneous injection; 3-12 months) does not present a carcinogenic risk in rodents[2].
Insulin glargine (450 mg/kg; subcutaneous injection; 6 months) has an improving effect in a mouse model of diabetes[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Seven-week-old male db/db mice[3]
Dosage: 450 mg/kg
Administration: Subcutaneous injection (s.c.); 6 months
Result: Significantly improved glucose tolerance.
Upregulated pancreatic β-cell functional genes, such as INS1, Pdx1, Pax4 and Pax6.
Clinical Trial
Molecular Weight

6062.89

Formula

C267H404N72O78S6

CAS No.
Appearance

Liquid

Color

Colorless to light yellow

Sequence

A-chain: Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Gly; B-chain: Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr-Arg-Arg (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19)

Sequence Shortening

A-chain: GIVEQCCTSICSLYQLENYCG; B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Store at 4°C, do not freeze

Purity & Documentation

Purity: 95.00%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Insulin glargine
Cat. No.:
HY-108719
Quantity:
MCE Japan Authorized Agent: