Klotho-derived peptide 1 hydrochloride (Synonyms: KP1 (human) hydrochloride)

Cat. No.: HY-P10414A Purity: 97.28%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Klotho-derived peptide 1 (KP1 human) hydrochloride blocks TGF-β/TGF-β receptor 2 interaction, inhibits TGF-β-induced activation of Smad2/3 and mitogen-activated protein kinase (MAPK), and exhibits anti-fibrotic and kidney protective effects in mouse model.

For research use only. We do not sell to patients.

Klotho-derived peptide 1 hydrochloride Chemical Structure

Size	Price	Stock	Quantity
1 mg	USD 130	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 360	In-stock	Estimated Time of Arrival: December 31
10 mg	USD 576	In-stock	Estimated Time of Arrival: December 31
50 mg		Get quote
100 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Klotho-derived peptide 1 hydrochloride:

Klotho-derived peptide 1 Get quote

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

View All p38 MAPK Isoform Specific Products:

View All Isoforms

p38 MAPK p38α p38β MAPK13 p38δ p38γ

Biological Activity
Purity & Documentation
References
Customer Review

Description

Molecular Weight

3228.44 (free base)

Formula

C₁₄₉H₂₀₃N₃₉O₄₃.xHCl

Appearance

Solid

Color

White to off-white

Sequence

Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly

Sequence Shortening

FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

H₂O : 50 mg/mL (Need ultrasonic)

0.1 M Acetic acid : 50 mg/mL (adjust pH to 2 with CH3COOH)

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 97.28%

Select Batch:

Data Sheet (277 KB) SDS (252 KB)

COA (258 KB) RP-HPLC (114 KB) MS (229 KB)

Handling Instructions (2659 KB)

References

[1]. Yuan Q, et al., A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-β signaling. Nat Commun. 2022 Jan 21;13(1):438. [Content Brief]

Klotho-derived peptide 1 hydrochloride Related Classifications

Inflammation/Immunology

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Klotho-derived peptide 1KP1 (human)TGF-beta/Smadp38 MAPKTransforming growth factor betaNRK-49Frenal fibrosisBALB/c mouseUIRIUUOInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks