1. GPCR/G Protein Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. Neuropeptide Y (2-36) (porcine)

Neuropeptide Y (2-36) (porcine) is a porcine-derived neuropeptide with 97.14% homology to rat/human origin. Neuropeptide Y (2-36) (porcine) is also a rat neuropeptide receptor agonist, with EC50 values of 1.2, 1.6 and 3.4 nM for receptor of Y5, Y2 and Y1 respectively. Neuropeptide Y (2-36) (porcine) can be used in studies related to obesity and eating disorders.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Neuropeptide Y (2-36) (porcine) Chemical Structure

Neuropeptide Y (2-36) (porcine) Chemical Structure

CAS No. : 102961-52-4

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All Neuropeptide Y Receptor Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Neuropeptide Y (2-36) (porcine) is a porcine-derived neuropeptide with 97.14% homology to rat/human origin. Neuropeptide Y (2-36) (porcine) is also a rat neuropeptide receptor agonist, with EC50 values of 1.2, 1.6 and 3.4 nM for receptor of Y5, Y2 and Y1 respectively. Neuropeptide Y (2-36) (porcine) can be used in studies related to obesity and eating disorders[1].

In Vitro

The following information is for reference:
Neuropeptide Y (2-36) (porcine): PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2
Neuropeptide Y (2-36) (human, rat): PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (97.14% homology to porcine).

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Neuropeptide Y (2-36) (porcine) (1.23 µg/rat; i.c.v.; single) induces food intake in rats[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male Sprague-Dawley rats (180-220 g)[1].
Dosage: 1.23 µg/rat (300 pmol/rat)
Administration: Intracerebroventricular injection; single
Result: Increased food intake to 5.0 g 4 hours later.
Molecular Weight

4090.47

Formula

C181H278N54O55

CAS No.
Sequence Shortening

PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuropeptide Y (2-36) (porcine)
Cat. No.:
HY-P3677
Quantity:
MCE Japan Authorized Agent: