1. GPCR/G Protein
  2. GHSR
  3. GRF (1-29) amide (rat)

GRF (1-29) amide (rat)  (Synonyms: rGHRH(1-29)NH2)

Cat. No.: HY-P1155 Purity: 99.94%
Handling Instructions Technical Support

GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GRF (1-29) amide (rat) Chemical Structure

GRF (1-29) amide (rat) Chemical Structure

CAS No. : 91826-20-9

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products

1 Publications Citing Use of MCE GRF (1-29) amide (rat)

View All GHSR Isoform Specific Products:

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.

In Vivo

Time course studies of GRF (1-29) amide (rat) disappearance show apparent half-lives of 18±4 min and 13±3 min in serum and liver homogenate, respectively. This is accompanied by the appearance of degradation products that are all less hydrophobic than the native peptide. In the serum, two major metabolites are detected and isolated by preparative HPLC[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3473.08

Formula

C155H251N49O40S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-NH2

Sequence Shortening

HADAIFTSSYRRILGQLYARKLLHEIMNR-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 16.67 mg/mL (4.80 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2879 mL 1.4396 mL 2.8793 mL
5 mM --- --- ---
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
Cell Assay
[1]

To isolate GRF metabolites in the liver, rGRF(1-29)NH2 (10 mg) is first preincubated in 232 mL of Krebs' buffer (5 min, 37°C) to help GRF solubilization and then incubated with a liver homogenate in a shaking bath at 37°C. The homogenate is prepared as in the degradation assays with 580 mg of liver (10 mg/mL). The reaction is stopped after 30 min by adding 174 mL of cold 50 mM phosphate solution (pH 0.8) and centrifugation (48,000×g, 20 min, 4°C). The supernatant is filtered twice and its pH is adjusted (3.0) with 6 N NaOH before chromatography. The GRF metabolites and residual rGRF(1-29)NH2 are isolated[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2879 mL 1.4396 mL 2.8793 mL 7.1982 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GRF (1-29) amide (rat)
Cat. No.:
HY-P1155
Quantity:
MCE Japan Authorized Agent: