2B4/CD244 Protein, Mouse (HEK293, His)

The CD244 protein is an activating receptor that regulates NK cells and CD8+ T cells. It enhances NK cell cytotoxicity, IFN-γ production, and granule exocytosis. 2B4/CD244 Protein, Mouse (HEK293, His) is the recombinant mouse-derived 2B4/CD244 protein, expressed by HEK293 , with C-6*His labeled tag.

The function of CD244 is to regulate the activity of natural killer (NK) cells and CD8+ T-cells. It acts as an activating receptor for NK cells, stimulating their cytotoxicity, production of IFN-gamma, and granule exocytosis. CD244 also enhances signals from other NK receptors, such as NCR3 and NCR1, to further activate NK cells. It is involved in the regulation of CD8+ T-cell proliferation and provides costimulatory-like function for neighboring T-cells. CD244 can also inhibit inflammatory responses in dendritic cells. The presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and SH2D1B/EAT-2, control the activity of CD244. It interacts with various proteins, including SH2D1A, FYN, VAV1, INPP5D/SHIP1, CBL, PTPN6/SHP-1, PTPN11/SHP-2, CSK, and MHC class I proteins. The interaction with CD48 is important for its function, and engagement of CD244 with CD48 expressed on neighboring NK cells is crucial for optimal expansion and activation of NK cells.

Mouse

HEK293

C-6*His

Q07763-1 (Q20-N221)

18106  [NCBI]

QDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVPSN

35-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.