1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. TNF Superfamily Ligands 4-1BBL
  5. 4-1BBL
  6. 4-1BBL/TNFSF9 Protein, Cynomolgus (HEK293, Fc)

4-1BBL/TNFSF9 Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P77287
Handling Instructions Technical Support

4-1BBL (4-1BB ligand) is a type II membrane protein of the TNF superfamily, is expressed on antigen-presenting cells. 4-1BB with 4-1BBL can induce T-cell expansion, cytokine induction, differentiation, and upregulation of anti-apoptotic genes as well as protect T cells from activation-induced cell death (AICD). 4-1BBL stimulates T cell proliferation and induces effective anti-tumor immune responses. 4-1BBL is an immunostimulant molecule that interacts with the 4-1BB high-affinity receptor during the antigen presentation, providing costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-kB, c-Jun, and p38 downstream pathways, triggering pleiotropic effects on the immune system. 4-1BBL/TNFSF9 Protein, Cynomolgus (HEK293, Fc) is a recombinant protein with a N-Terminal Fc label, It consists of 184 amino acids (R68-E251) and is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

4-1BBL (4-1BB ligand) is a type II membrane protein of the TNF superfamily, is expressed on antigen-presenting cells. 4-1BB with 4-1BBL can induce T-cell expansion, cytokine induction, differentiation, and upregulation of anti-apoptotic genes as well as protect T cells from activation-induced cell death (AICD)[1]. 4-1BBL stimulates T cell proliferation and induces effective anti-tumor immune responses[3]. 4-1BBL is an immunostimulant molecule that interacts with the 4-1BB high-affinity receptor during the antigen presentation, providing costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-kB, c-Jun, and p38 downstream pathways, triggering pleiotropic effects on the immune system[4]. 4-1BBL/TNFSF9 Protein, Cynomolgus (HEK293, Fc) is a recombinant protein with a N-Terminal Fc label, It consists of 184 amino acids (R68-E251) and is produced in HEK293 cells.

Background

4-1BBL is expressed on a variety of antigen presenting cells (APCs), including activated B cells, dendritic cells, macrophages, and myeloid cells[1].
The amino acid sequence of human 4-1BBL protein has low homology for mouse and rat 4-1BBL protein.
4-1BBL binds to high-affinity 4-1BB, resulting in the recruitment of intracellular TRAF adaptor molecules (TRAF1 and TRAF2), and then activate of NF-jB and the extracellular signal regulated kinase (ERK), c-Jun N-terminal kinase (JNK) and p38 mitogen-associated protein (MAP) kinase signaling cascades. The binding of 4-1BBL to 4-1BB generates strong co-stimulatory signals in T-cells that lead to up-regulation of anti-apoptotic molecules, cytokine secretion, and enhanced effector function[2].
4-1BBL is a member of the TNF family of proteins. 4-1BBL is an immunostimulant molecule that interacts with the 4-1BB high-affinity receptor during the antigen presentation, providing costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-kB, c-Jun, and p38 downstream pathways, triggering pleiotropic effects on the immune system[4]. 4-1BBL significantly induces T cell proliferation and increases the stimulation of both IL-2 and IFN-γ[5].

In Vitro

4-1BB (Cynomolgus monkey) binds to STA551, and Uto-hIgG2 with Kd value of 25.1 nM and 130 nM, respectively[4].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rat 4-1BB/TNFRSF9 is Immobilized at 100 ng/mL (100 µL/well), can bind Cynomolgus 4-1BB Ligand/TNFSF9. The ED50 for this effect is 2.665 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Rat 4-1BB/TNFRSF9 is Immobilized at 100 ng/mL (100 µL/well), can bind Cynomolgus 4-1BB Ligand/TNFSF9 .The ED50 for this effect is 2.665 ng/mL.
Species

Cynomolgus

Source

HEK293

Tag

N-hFc

Accession

XP_015296398 (R68-E251)

Gene ID
Molecular Construction
N-term
hFc
4-1BBL (R68-E251)
Accession # XP_015296398
C-term
Synonyms
Tumor necrosis factor ligand superfamily member 9; CD137L; 4-1BB Ligand
AA Sequence

REGPELSPDNPAGLLDLRQGMFAQLVAQNVLLTDGPLSWYSDPGLAGVSLAEGLSYKEDTKELVVAKAGVYYVFLQLMLQRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPSASSEARNSAFGFQGRLLHLGAGQRLGVHLHTEARACHAWQLTQGATVLGLFRVTPEVPAGLSSPRSE

Molecular Weight

Approximately 47.8 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

4-1BBL/TNFSF9 Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BBL/TNFSF9 Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P77287
Quantity:
MCE Japan Authorized Agent: