1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. TNF Superfamily Ligands 4-1BBL/CD137L
  5. 4-1BBL
  6. 4-1BBL/TNFSF9 Protein, Mouse (HEK293, His)

4-1BBL/TNFSF9 Protein, Mouse (HEK293, His)

Cat. No.: HY-P7446
COA Handling Instructions

4-1BBL (4-1BB ligand) is a type II membrane protein of the TNF superfamily, is expressed on antigen-presenting cells. 4-1BB with 4-1BBL can induce T-cell expansion, cytokine induction, differentiation, and upregulation of anti-apoptotic genes as well as protect T cells from activation-induced cell death (AICD). 4-1BBL stimulates T cell proliferation and induces effective anti-tumor immune responses. 4-1BBL is an immunostimulant molecule that interacts with the 4-1BB high-affinity receptor during the antigen presentation, providing costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-kB, c-Jun, and p38 downstream pathways, triggering pleiotropic effects on the immune system. 4-1BBL/TNFSF9 Protein, Mouse (HEK293, His) is a recombinant protein with a N-Terminal His label, It consists of 206 amino acids (R104-E309) and is produced in HEK293 cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $35 In-stock
10 μg $86 In-stock
50 μg $240 In-stock
100 μg $400 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

4-1BBL (4-1BB ligand) is a type II membrane protein of the TNF superfamily, is expressed on antigen-presenting cells. 4-1BB with 4-1BBL can induce T-cell expansion, cytokine induction, differentiation, and upregulation of anti-apoptotic genes as well as protect T cells from activation-induced cell death (AICD)[1]. 4-1BBL stimulates T cell proliferation and induces effective anti-tumor immune responses[3]. 4-1BBL is an immunostimulant molecule that interacts with the 4-1BB high-affinity receptor during the antigen presentation, providing costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-kB, c-Jun, and p38 downstream pathways, triggering pleiotropic effects on the immune system[4]. 4-1BBL/TNFSF9 Protein, Mouse (HEK293, His) is a recombinant protein with a N-Terminal His label, It consists of 206 amino acids (R104-E309) and is produced in HEK293 cells.

Background

4-1BBL is expressed on a variety of antigen presenting cells (APCs), including activated B cells, dendritic cells, macrophages, and myeloid cells[1].
The amino acid sequence of human 4-1BBL protein has low homology for mouse and rat 4-1BBL protein.
4-1BBL binds to high-affinity 4-1BB, resulting in the recruitment of intracellular TRAF adaptor molecules (TRAF1 and TRAF2), and then activate of NF-jB and the extracellular signal regulated kinase (ERK), c-Jun N-terminal kinase (JNK) and p38 mitogen-associated protein (MAP) kinase signaling cascades. The binding of 4-1BBL to 4-1BB generates strong co-stimulatory signals in T-cells that lead to up-regulation of anti-apoptotic molecules, cytokine secretion, and enhanced effector function[2].
4-1BBL is a member of the TNF family of proteins. 4-1BBL is an immunostimulant molecule that interacts with the 4-1BB high-affinity receptor during the antigen presentation, providing costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-kB, c-Jun, and p38 downstream pathways, triggering pleiotropic effects on the immune system[4]. 4-1BBL significantly induces T cell proliferation and increases the stimulation of both IL-2 and IFN-γ[5].

In Vitro

4-1BB (hamster ovary; 5 μg/mL; 16 h) costimulates B lymphocyte proliferation[4].

Biological Activity

Measured by its ability to co-stimulate IL-2 secretion by mouse T cells in the presence of anti-CD3. The ED50 for this effect is 2.149 ng/mL, corresponding to a specific activity is 4.65×10^5 U/mg.

  • Measured by its ability to co-stimulate IL-2 secretion by mouse T cells in the presence of anti-CD3.The ED50 for this effect is 2.149 ng/mL, corresponding to a specific activity is 4.65×105 U/mg.
Species

Mouse

Source

HEK293

Tag

N-10*His

Accession

P41274 (R104-E309)

Gene ID

21950  [NCBI]

Molecular Construction
N-term
10*His
4-1BBL (R104-E309)
Accession # P41274
C-term
Synonyms
rMu4-1BB Ligand/TNFSF9, His; 4-1BBL; CD137L; 4-1BB Ligand; TNFSF9
AA Sequence

HHHHHHHHHHRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE

Molecular Weight

approximately 38.72 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BBL/TNFSF9 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7446
Quantity:
MCE Japan Authorized Agent: