1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. TNF Receptor Superfamily 4-1BB
  5. 4-1BB
  6. 4-1BB/TNFRSF9 Protein, Human (HEK293, Fc)

4-1BB/TNFRSF9 Protein, Human (HEK293, Fc), a recombinant human 4-1BB/TNFRSF9 Protein produced in HEK293 cells, has an Fc fragment at the C-terminus. Recombinant Human 4-1BBRTNFRSF9, an inducible T cell molecule belonging to the TNF receptor superfamily, could promote the expansion of antigen-specific T cells and prevent activation-induced death of CD8+ T cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

4-1BB/TNFRSF9 Protein, Human (HEK293, Fc), a recombinant human 4-1BB/TNFRSF9 Protein produced in HEK293 cells, has an Fc fragment at the C-terminus. Recombinant Human 4-1BBRTNFRSF9, an inducible T cell molecule belonging to the TNF receptor superfamily, could promote the expansion of antigen-specific T cells and prevent activation-induced death of CD8+ T cells[1].

Background

Recombinant Human 4-1BB/TNFRSF9 (CD137) is an inducible T cell molecule belonging to the TNF receptor superfamily. It has been shown that signaling through CD137 by either its natural ligand, 4-1BBL, or by agonistic Ab’s costimulates activation of CD4+ and CD8+ T cells in a CD28-independent fashion, leading to activation of the NF-κB, c-Jun NH2-terminal kinase/stress-activated protein kinase (JNK/SAPK), and p38 signaling pathways. In addition to its role in promoting the expansion of antigen-specific T cells, CD137 signaling may also prevent activation-induced death of CD8+ T cells[1].

In Vitro

4-1BB (human; 1 μg/mL; 16 h) leads to induction of monocyte activation and induces Myc protein production[4].
4-1BB (human; 1 μg/mL; 1 d) prolongs survival of peripheral monocytes and (1 μg/mL; 1 h) induces expression of M-CSF[5].
4-1BB (human; 1.2-4 μg/mL; 7 d) exhibits nhancement of cell numbers dose-dependently[6].

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q07011 (L24-Q186)

Gene ID
Molecular Construction
N-term
4-1BB (L24-Q186)
Accession # Q07011
hFc
C-term
Synonyms
CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA
AA Sequence

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Molecular Weight

Approximately 58.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

4-1BB/TNFRSF9 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BB/TNFRSF9 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70681
Quantity:
MCE Japan Authorized Agent: