AGRP Protein, Mouse (50a.a, HEK293, Fc)

The AGRP protein, encoded by the AGRP gene, regulates feeding behavior and body weight. It acts as a melanocortin receptor signaling antagonist, influencing appetite and metabolic balance. AGRP has multiple splice variants, adding to its regulatory complexity. Its expression extends beyond the central nervous system, with presence in tissues like the testis and placenta, indicating systemic involvement in physiological processes. AGRP Protein, Mouse (50a.a, HEK293, Fc) is the recombinant mouse-derived AGRP protein, expressed by HEK293 , with N-hFc labeled tag.

The AGRP gene encodes a protein crucial for the regulation of feeding behavior and plays a key role in controlling body weight. Functioning as an antagonist of melanocortin receptor signaling, the encoded protein is involved in intricate pathways that govern appetite and metabolic balance. Multiple alternatively spliced transcript variants of this gene have been identified, contributing to the complexity of its regulatory functions. The expression of AGRP is widespread, with presence observed in various tissues, including the testis and placenta in adults, indicating its systemic involvement in physiological processes beyond the central nervous system.

Mouse

HEK293

N-hFc

P56473/NP_031453.1 (S82-T131)

11604  [NCBI]

SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT

Approximately 35-40 kDa due to the glycosylation.

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.