1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Animal-free Recombinant Proteins
  3. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands CD30L/CD153 CD30L/CD153
  5. CD30L/CD153
  6. Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His)

Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His)

Cat. No.: HY-P700036AF
SDS COA Handling Instructions Technical Support

CD30 ligand/TNFSF8 protein is a cytokine that specifically binds to TNFRSF8/CD30 and acts as a potent inducer of T cell proliferation. As a homotrimer, this ligand plays a crucial role in regulating T cell activation and growth, contributing to the dynamic coordination of immune responses. Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His) is the recombinant human-derived animal-FreeCD30 Ligand/TNFSF8 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His) is 172 a.a., with molecular weight of ~20.57 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD30 ligand/TNFSF8 protein is a cytokine that specifically binds to TNFRSF8/CD30 and acts as a potent inducer of T cell proliferation. As a homotrimer, this ligand plays a crucial role in regulating T cell activation and growth, contributing to the dynamic coordination of immune responses. Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His) is the recombinant human-derived animal-FreeCD30 Ligand/TNFSF8 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His) is 172 a.a., with molecular weight of ~20.57 kDa.

Background

CD30 Ligand/TNFSF8 protein, a cytokine, specifically binds to TNFRSF8/CD30, acting as a potent inducer of T-cell proliferation. Operating as a homotrimer, this ligand plays a crucial role in regulating the activation and growth of T-cells, contributing to the dynamic orchestration of immune responses. The interaction between CD30 Ligand and its receptor, TNFRSF8/CD30, highlights its significance as a molecular trigger for the robust expansion of T-cell populations.

Biological Activity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <2 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

P32971 (Q63-D234)

Gene ID

944  [NCBI]

Molecular Construction
N-term
CD30L (Q63-D234)
Accession # P32971
His
C-term
Synonyms
soluble CD30 Ligand; Tumor necrosis factor ligand superfamily member 8; CD153; CD30L; CD30LG
AA Sequence

MQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Molecular Weight

Approximately 20.57 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free CD30 Ligand/TNFSF8 Protein, Human (His)
Cat. No.:
HY-P700036AF
Quantity:
MCE Japan Authorized Agent: