Animal-Free MIG/CXCL9 Protein, Pig (His)

The CXCL9 protein is part of the intercrine alpha family of chemokines critical for cell-to-cell communication and immune responses. In this family, CXCL9 may play a key role in regulating inflammatory processes and influencing cellular interactions. Animal-Free MIG/CXCL9 Protein, Pig (His) is the recombinant pig-derived animal-Free CXCL9 protein, expressed by E. coli , with N-His labeled tag.

The CXCL9 protein is a member of the intercrine alpha (chemokine CxC) family, indicating its involvement in a group of chemokines crucial for intercellular communication and immune responses. Within the intercrine alpha family, CXCL9 likely plays a key role in modulating inflammatory processes and influencing cellular interactions. Further investigation is essential to reveal the specific functions and implications of this protein within the broader framework of the chemokine CxC family.

Pig

E. coli

N-His

B0FYK2 (T23-T126)

100135681  [NCBI]

TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT

Approximately 12.88 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.