Animal-Free FGF-1 Protein, Human (His)

FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. Animal-Free FGF-1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-1 protein, expressed by E. coli , with C-His labeled tag.

FGF-1 Protein assumes a pivotal role in intricately regulating cell survival, division, angiogenesis, differentiation, and migration. Functioning as a potent mitogen in vitro, it acts as a ligand for FGFR1 and integrins. Binding to FGFR1, particularly in the presence of heparin, leads to FGFR1 dimerization and activation through sequential autophosphorylation on tyrosine residues. This activation serves as docking sites for interacting proteins, initiating several signaling cascades. Furthermore, FGF-1 Protein binds to integrin ITGAV:ITGB3, forming a ternary complex with integrin and FGFR1, crucial for FGF1 signaling. Inducing the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, it demonstrates its involvement in diverse cellular processes. Additionally, FGF-1 Protein's ability to induce angiogenesis further underscores its multifaceted role. Interactions with FGFRs, integrins, and various proteins within complex networks highlight its intricate participation in cellular signaling pathways, emphasizing its significance in cell physiology.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <0.3 ng/mL. The specific activity of recombinant human FGF-1 is >1 x 10⁶ IU/mg.

Human

E. coli

C-His

P05230-1 (F16-D155)

2246  [NCBI]

MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Approximately 16.77 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.