Animal-Free FGF-8a Protein, Human (His)

Animal-Free FGF-8a Protein, Human (His) is the recombinant human-derived animal-FreeFGF-8a protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-8a Protein, Human (His) is 182 a.a., with molecular weight of ~22.14 kDa.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <2 μg/mL.

Human

E. coli

C-His

P55075-2 (Q23-R204)

2253  [NCBI]

MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Approximately 22.14 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.