1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. CSF & Receptors
  4. G-CSF
  5. Animal-Free G-CSF Protein, Human (His)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. Animal-Free G-CSF Protein, Human (His) is the recombinant human-derived animal-FreeG-CSF protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free G-CSF Protein, Human (His) is 174 a.a., with molecular weight of ~19.48 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg USD 75 In-stock
10 μg USD 210 In-stock
50 μg USD 588 In-stock
100 μg   Get quote  

Get it by April 8 for select sizes. Order within 17 hrs 50 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. Animal-Free G-CSF Protein, Human (His) is the recombinant human-derived animal-FreeG-CSF protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free G-CSF Protein, Human (His) is 174 a.a., with molecular weight of ~19.48 kDa.This product is for cell culture use only.

Background

Granulocyte/macrophage colony-stimulating factor (G-CSF) is a cytokine crucial for hematopoiesis, exerting control over the production, differentiation, and function of two key white cell populations: granulocytes and monocytes-macrophages. As a monomeric protein, G-CSF specifically induces the development of granulocytes, contributing to the regulation of the immune system and blood cell formation.

Biological Activity

Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <50 pg/mL. The specific activity of recombinant human G-CSF is >2 x 107 IU/mg

Species

Human

Source

E. coli

Tag

N-His

Accession

P09919-2 (T31-P204)

Gene ID
Molecular Construction
N-term
His
G-CSF (T31-P204)
Accession # P09919-2
C-term
Synonyms
CSF-3; MGI-1G; GM-CSF beta; pluripoietin
AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Weight

Approximately 19.48 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free G-CSF Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free G-CSF Protein, Human (His)
Cat. No.:
HY-P700083AF
Quantity:
MCE Japan Authorized Agent: