Animal-Free GM-CSF Protein, Mouse (His)

GM-CSF Protein, a renowned cytokine, promotes the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. Operating as a monomer, it interacts with the GM-CSF receptor complex. This complex, comprising two head-to-head hexamers with two alpha, two beta, and two ligand subunits, forms a dodecamer structure. Animal-Free GM-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeGM-CSF protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free GM-CSF Protein, Mouse (His) is 124 a.a., with molecular weight of ~15.1 kDa.

GM-CSF Protein is a cytokine renowned for its ability to promote the growth and differentiation of hematopoietic precursor cells from diverse lineages, such as granulocytes, macrophages, eosinophils, and erythrocytes. It functions as a monomer and interacts with the GM-CSF receptor complex, which consists of two head-to-head hexamers containing two alpha, two beta, and two ligand subunits, ultimately forming a dodecamer structure.

Measure by its ability to induce proliferation in FDC-P1 cells. The ED₅₀ for this effect is <50 pg/mL. The specific activity of recombinant mouse GM-CSF is approximately >2x10⁵ IU/mg.

Mouse

E. coli

N-His

Q14AD9 (A18-K141)

12981

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Approximately 15.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.