Animal-Free IFN-omega Protein, Human (His)

IFN-omega protein is a member of the alpha/beta interferon family. Animal-Free IFN-omega 1 Protein, Human (His) is the recombinant human-derived animal-FreeIFN-omega protein, expressed by E. coli , with C-His labeled tag.

IFN-omega protein belongs to the alpha/beta interferon family.

Measure by its ability to induce cytotoxicity in TF-1 cells. The ED₅₀ for this effect is <0.02 ng/mL. The specific activity of recombinant human IFN omega is approximately >5 x10⁷ IU/ mg.

Human

E. coli

C-His

P05000 (C24-S195)

3467  [NCBI]

MCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

Approximately 20.93 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.