1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-24
  5. Animal-Free IL-24 Protein, Human (His)

Animal-Free IL-24 Protein, Human (His)

Cat. No.: HY-P700115AF
Data Sheet SDS COA Handling Instructions

IL-24 protein, produced by T-cells, regulates immune responses, tissue homeostasis, defense, and oncogenesis. It induces type I interferon response in influenza infection, signaling through IL20RA/IL20RB or IL20RB/IL22RA1 receptor complexes to stimulate JAK1-STAT3 and MAPK pathways. IL-24 promotes secretion of IL8 and MMP1, maintains ER homeostasis, and serves as a quality control mechanism for the ubiquitin proteasome system. Animal-Free IL-24 Protein, Human (His) is the recombinant human-derived animal-FreeIL-24 protein, expressed by E. coli , with C-His labeled tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg USD 160 In-stock
50 μg USD 450 In-stock
100 μg   Get quote  

Get it tomorrow January 10 by noon. Order within 0 hrs 51 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-24 protein, produced by T-cells, regulates immune responses, tissue homeostasis, defense, and oncogenesis. It induces type I interferon response in influenza infection, signaling through IL20RA/IL20RB or IL20RB/IL22RA1 receptor complexes to stimulate JAK1-STAT3 and MAPK pathways. IL-24 promotes secretion of IL8 and MMP1, maintains ER homeostasis, and serves as a quality control mechanism for the ubiquitin proteasome system. Animal-Free IL-24 Protein, Human (His) is the recombinant human-derived animal-FreeIL-24 protein, expressed by E. coli , with C-His labeled tag.

Background

IL-24 protein, a multifunctional cytokine primarily produced by T-cells, orchestrates a regulatory role in immune responses, tissue homeostasis, host defense, and oncogenesis. Demonstrating antiviral functions, IL-24 induces the type I interferon response during influenza infection. The cytokine signals through two receptor complexes, IL20RA/IL20RB or IL20RB/IL22RA1, stimulating the JAK1-STAT3 and MAPK pathways, thereby promoting the secretion of pro-inflammatory mediators, including IL8 and MMP1. Intracellularly, IL-24 maintains endoplasmic reticulum homeostasis by constraining the eIF2alpha-CHOP pathway-mediated stress signal. Additionally, it acts as a quality control mechanism for the ubiquitin proteasome system, detecting proteasome dysfunction and activating PKR/EIF2AK2.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human IL-20R alpha and IL-20R beta. The ED50 for this effect is <100 pg/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q13007-1 (Q52-L206)

Gene ID
Molecular Construction
N-term
IL-24 (Q52-L206)
Accession # Q13007-1
His
C-term
Synonyms
Interleukin-24; Melanoma differentiation-associated gene 7 protein; MDA-7; ST16
AA Sequence

MQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Molecular Weight

Approximately 19.10 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-24 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-24 Protein, Human (His)
Cat. No.:
HY-P700115AF
Quantity:
MCE Japan Authorized Agent: