Animal-Free IL-36RN Protein, Mouse (His)

IL-36RN Protein inhibits IL36A, IL36B and IL36G receptors by binding to IL1RL2/IL-36R, blocking their association with IL1RAP and inhibiting downstream signaling. It is an important component of the IL-36 signaling system and participates in the local inflammatory response of the epithelial barrier. Animal-Free IL-36RN Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36RN protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-36RN Protein, Mouse (His) is 155 a.a., with molecular weight of ~17.81 kDa.

The IL-36RN Protein acts as an inhibitor by binding to the interleukin-36 (IL36A, IL36B, and IL36G) receptor IL1RL2/IL-36R, preventing its association with the coreceptor IL1RAP and inhibiting downstream signaling. This protein is a crucial component of the IL-36 signaling system, which is implicated in local inflammatory responses, particularly in epithelial barriers. Proposed to play a role in skin inflammation and contribute to the innate immune response against fungal pathogens, the IL-36RN Protein may activate an anti-inflammatory signaling pathway by recruiting SIGIRR. Notably, it interacts with the cargo receptor TMED10, facilitating translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion.

Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <2 µg/mL

Mouse

E. coli

C-His

Q9QYY1 (M2-D156)

54450  [NCBI]

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Approximately 17.81 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.