Animal-Free IL-4 Protein, Pig (His)

IL-4 protein is actively involved in the activation process of B cells and various cell types, acting as a costimulator of DNA synthesis. It induces expression of MHC class II molecules by resting B cells and enhances IgE and IgG1 secretion and cell surface expression. Animal-Free IL-4 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-4 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-4 Protein, Pig (His) is 109 a.a., with molecular weight of ~13.5 kDa.

IL-4 protein actively participates in several B-cell activation processes and various cell types, serving as a costimulator of DNA synthesis. It induces the expression of class II MHC molecules on resting B-cells, enhances the secretion and cell surface expression of IgE and IgG1, and regulates the expression of the low affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Additionally, IL-4 positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <0.6 ng/mL.

Pig

E. coli

C-His

Q04745 (H25-C133)

397225  [NCBI]

MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC

Approximately 13.5 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.