1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-4
  5. Animal-Free IL-4 Protein, Pig (His)

IL-4 protein is actively involved in the activation process of B cells and various cell types, acting as a costimulator of DNA synthesis. It induces expression of MHC class II molecules by resting B cells and enhances IgE and IgG1 secretion and cell surface expression. Animal-Free IL-4 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-4 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-4 Protein, Pig (His) is 109 a.a., with molecular weight of ~13.5 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free IL-4 Protein, Pig (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-4 protein is actively involved in the activation process of B cells and various cell types, acting as a costimulator of DNA synthesis. It induces expression of MHC class II molecules by resting B cells and enhances IgE and IgG1 secretion and cell surface expression. Animal-Free IL-4 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-4 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-4 Protein, Pig (His) is 109 a.a., with molecular weight of ~13.5 kDa.

Background

IL-4 protein actively participates in several B-cell activation processes and various cell types, serving as a costimulator of DNA synthesis. It induces the expression of class II MHC molecules on resting B-cells, enhances the secretion and cell surface expression of IgE and IgG1, and regulates the expression of the low affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Additionally, IL-4 positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Biological Activity

Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL.

Species

Pig

Source

E. coli

Tag

C-His

Accession

Q04745 (H25-C133)

Gene ID
Molecular Construction
N-term
IL-4 (H25-C133)
Accession # Q04745
His
C-term
Synonyms
rPoIL-4; BSF-1; IL4
AA Sequence

MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC

Molecular Weight

Approximately 13.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-4 Protein, Pig (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-4 Protein, Pig (His)
Cat. No.:
HY-P700248AF
Quantity:
MCE Japan Authorized Agent: