1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-10
  6. Animal-Free KGF-2/FGF-10 Protein, Human (His)

Animal-Free KGF-2/FGF-10 Protein, Human (His)

Cat. No.: HY-P7342AF
SDS COA Handling Instructions

KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. Animal-Free KGF-2/FGF-10 Protein, Human (His) is the recombinant human-derived animal-FreeKGF-2/FGF-10 protein, expressed by E. coli , with C-His, C-His labeled tag. The total length of Animal-Free KGF-2/FGF-10 Protein, Human (His) is 169 a.a., with molecular weight of ~20.06 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $65 In-stock
10 μg $180 In-stock
50 μg $450 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KGF-2/FGF-10 proteins coordinate embryonic development, regulate cell proliferation and differentiation, and are indispensable in branching morphogenesis. This multifunctional protein may aid in wound healing. Animal-Free KGF-2/FGF-10 Protein, Human (His) is the recombinant human-derived animal-FreeKGF-2/FGF-10 protein, expressed by E. coli , with C-His, C-His labeled tag. The total length of Animal-Free KGF-2/FGF-10 Protein, Human (His) is 169 a.a., with molecular weight of ~20.06 kDa.

Background

KGF-2/FGF-10 Protein assumes a crucial role in orchestrating embryonic development, exerting regulatory control over essential processes such as cell proliferation and differentiation. Its significance extends to the intricate domain of normal branching morphogenesis, where KGF-2/FGF-10 is indispensable. This versatile protein may also contribute to wound healing processes. Through crucial interactions, it engages with FGFR1 and FGFR2, forming molecular complexes that underlie its multifaceted functions. Furthermore, KGF-2/FGF-10 interacts with FGFBP1, emphasizing its intricate network of associations in orchestrating cellular responses and developmental events.

Biological Activity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <8 ng/mL. The specific activity of recombinant human FGF-10 is >1.2 x 105 IU/mg.

Species

Human

Source

E. coli

Tag

C-His;C-His

Accession

O15520 (L40-S208)

Gene ID
Molecular Construction
N-term
FGF-10 (L40-S208)
Accession # O15520
His
C-term
Synonyms
FGF-10; Fibroblast Growth Factor-10; Keratinocyte growth factor-2
AA Sequence

MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Molecular Weight

Approximately 20.06 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free KGF-2/FGF-10 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free KGF-2/FGF-10 Protein, Human (His)
Cat. No.:
HY-P7342AF
Quantity:
MCE Japan Authorized Agent: