1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TNF Superfamily Neurotrophic Factors
  4. TNF Superfamily Ligands
  5. TNF-alpha
  6. Animal-Free TNF-alpha/TNFSF2 Protein, Pig (His)

Animal-Free TNF-alpha/TNFSF2 Protein, Pig (His)

Cat. No.: HY-P700252AF
SDS COA Handling Instructions Technical Support

TNF-α/TNFSF2 protein is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and has multiple biological functions. It has the ability to induce cell death in specific tumor cell lines, serves as a potent pyrogen, can cause fever through direct action or stimulation of interleukin-1 secretion, and is involved in the induction of cachexia. Animal-Free TNF-alpha/TNFSF2 Protein, Pig (His) is the recombinant pig-derived animal-FreeTNF-alpha/TNFSF2 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free TNF-alpha/TNFSF2 Protein, Pig (His) is 156 a.a., with molecular weight of ~18.1 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNF-α/TNFSF2 protein is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and has multiple biological functions. It has the ability to induce cell death in specific tumor cell lines, serves as a potent pyrogen, can cause fever through direct action or stimulation of interleukin-1 secretion, and is involved in the induction of cachexia. Animal-Free TNF-alpha/TNFSF2 Protein, Pig (His) is the recombinant pig-derived animal-FreeTNF-alpha/TNFSF2 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free TNF-alpha/TNFSF2 Protein, Pig (His) is 156 a.a., with molecular weight of ~18.1 kDa.

Background

TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, predominantly secreted by macrophages and exhibiting diverse biological functions. It possesses the capability to induce cell death in specific tumor cell lines, serving as a potent pyrogen that can cause fever through direct action or by stimulating interleukin-1 secretion, and is implicated in the induction of cachexia. Under certain conditions, TNF-alpha/TNFSF2 can play a role in both stimulating cell proliferation and inducing cell differentiation. It also contributes to insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, with additional effects on GKAP42 protein degradation. Furthermore, TNF-alpha/TNFSF2 participates in angiogenesis by synergistically inducing VEGF production with IL1B and IL6, and promotes osteoclastogenesis, thereby mediating bone resorption. The intracellular domain (ICD) form of TNF-alpha induces IL12 production in dendritic cells, further highlighting its multifaceted impact on diverse cellular processes.

Biological Activity

Measure by its abilty to induce cytotoxicity in PK15 cells in the presence of the actinomycin D.The ED50for this effect is < 15 pg/mL.

Species

Pig

Source

E. coli

Tag

C-His

Accession

P23563 (L77-L232)

Gene ID

397086

Molecular Construction
N-term
TGF-α (L77-L232)
Accession # P23563
His
C-term
Synonyms
APC1 protein; Cachectin; DIF; TNF; TNFalpha; TNFATNF; TNFSF1A; TNFSF2; TNFA; TNFα; DIF; TNFSF2
AA Sequence

MLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL

Molecular Weight

Approximately 18.1 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free TNF-alpha/TNFSF2 Protein, Pig (His)
Cat. No.:
HY-P700252AF
Quantity:
MCE Japan Authorized Agent: