Animal-Free TNF-alpha/TNFSF2 Protein, Pig (His)

TNF-α/TNFSF2 protein is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and has multiple biological functions. It has the ability to induce cell death in specific tumor cell lines, serves as a potent pyrogen, can cause fever through direct action or stimulation of interleukin-1 secretion, and is involved in the induction of cachexia. Animal-Free TNF-alpha/TNFSF2 Protein, Pig (His) is the recombinant pig-derived animal-FreeTNF-alpha/TNFSF2 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free TNF-alpha/TNFSF2 Protein, Pig (His) is 156 a.a., with molecular weight of ~18.1 kDa.

TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, predominantly secreted by macrophages and exhibiting diverse biological functions. It possesses the capability to induce cell death in specific tumor cell lines, serving as a potent pyrogen that can cause fever through direct action or by stimulating interleukin-1 secretion, and is implicated in the induction of cachexia. Under certain conditions, TNF-alpha/TNFSF2 can play a role in both stimulating cell proliferation and inducing cell differentiation. It also contributes to insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, with additional effects on GKAP42 protein degradation. Furthermore, TNF-alpha/TNFSF2 participates in angiogenesis by synergistically inducing VEGF production with IL1B and IL6, and promotes osteoclastogenesis, thereby mediating bone resorption. The intracellular domain (ICD) form of TNF-alpha induces IL12 production in dendritic cells, further highlighting its multifaceted impact on diverse cellular processes.

Measure by its abilty to induce cytotoxicity in PK15 cells in the presence of the actinomycin D.The ED₅₀for this effect is < 15 pg/mL.

Pig

E. coli

C-His

P23563 (L77-L232)

397086

MLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL

Approximately 18.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.