Animal-Free VEGF Protein, Pig (His)

The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. Animal-Free VEGF Protein, Pig (His) is the recombinant pig-derived animal-FreeVEGF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free VEGF Protein, Pig (His) is 164 a.a., with molecular weight of ~20.16 kDa.

The VEGF-A Protein, a versatile growth factor, plays a crucial role in angiogenesis, vasculogenesis, and endothelial cell growth. Its diverse effects include inducing endothelial cell proliferation, promoting cell migration, inhibiting apoptosis, and inducing permeabilization of blood vessels. VEGF-A achieves these functions by binding to receptors FLT1/VEGFR1 and KDR/VEGFR2, as well as heparan sulfate and heparin. Notably, its interaction with the NRP1 receptor initiates a signaling pathway essential for motor neuron axon guidance and cell body migration during embryonic development. Additionally, VEGF-A binds to the DEAR/FBXW7-AS1 receptor, further expanding its regulatory roles. Structurally, VEGF-A exists as a homodimer linked by disulfide bonds and can also form heterodimers with PGF. Interactions with NRP1 and BSG underscore the intricate molecular relationships that underlie the multifaceted functions of VEGF-A in orchestrating vascular processes and embryonic development.

Pig

E. coli

C-His

P49151 (A27-R190)

397157  [NCBI]

MAPMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Approximately 20.16 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.