1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-A
  6. Animal-Free VEGF Protein, Pig (His)

The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. Animal-Free VEGF Protein, Pig (His) is the recombinant pig-derived animal-FreeVEGF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free VEGF Protein, Pig (His) is 164 a.a., with molecular weight of ~20.16 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. Animal-Free VEGF Protein, Pig (His) is the recombinant pig-derived animal-FreeVEGF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free VEGF Protein, Pig (His) is 164 a.a., with molecular weight of ~20.16 kDa.

Background

The VEGF-A Protein, a versatile growth factor, plays a crucial role in angiogenesis, vasculogenesis, and endothelial cell growth. Its diverse effects include inducing endothelial cell proliferation, promoting cell migration, inhibiting apoptosis, and inducing permeabilization of blood vessels. VEGF-A achieves these functions by binding to receptors FLT1/VEGFR1 and KDR/VEGFR2, as well as heparan sulfate and heparin. Notably, its interaction with the NRP1 receptor initiates a signaling pathway essential for motor neuron axon guidance and cell body migration during embryonic development. Additionally, VEGF-A binds to the DEAR/FBXW7-AS1 receptor, further expanding its regulatory roles. Structurally, VEGF-A exists as a homodimer linked by disulfide bonds and can also form heterodimers with PGF. Interactions with NRP1 and BSG underscore the intricate molecular relationships that underlie the multifaceted functions of VEGF-A in orchestrating vascular processes and embryonic development.

Species

Pig

Source

E. coli

Tag

C-His

Accession

P49151 (A27-R190)

Gene ID
Molecular Construction
N-term
VEGF (A27-R190)
Accession # P49151
His
C-term
Synonyms
VEGFA; VEGFVascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF
AA Sequence

MAPMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Weight

Approximately 20.16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Documentation

Animal-Free VEGF Protein, Pig (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free VEGF Protein, Pig (His)
Cat. No.:
HY-P72280AF
Quantity:
MCE Japan Authorized Agent: