APBA3 Protein, Human (His)

APBA3 Protein, Human (rHuAPBA3, His; Amyloid beta A4 precursor protein-binding family A member 3; APBA3) is an approximately 20.0 kDa APBA3 protein fused to His-tag. APBA3 Protein, Human (His) is an adapter protein that belongs to the X11 family and is involved in signal transduction processes^[1].

APBA3 is a third member of the X11 protein family interacting with Alzheimer's â-amyloid precursor protein (APP). The gene spans about 11 kb and is composed of 10 coding exons and one untranslated exon. The APBA3 was localized by radiation hybrid mapping to chromosome 19.
APBA3 contains PDZ (DHR) domains and 1 PID domain and interacts with the Alzheimer's disease amyloid precursor protein. APBA3 is widely expressed in many tissues and exhibiting lower levels in brain and testis^[1].

Human

E. coli

C-6*His

O96018 (M1-L138)

9546  [NCBI]

MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRLHHHHHH

Approximately 20.0 kDa

Greater than 80% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. H Tanahashi, et al. Genomic organization of the human X11L2 gene (APBA3), a third member of the X11 protein family interacting with Alzheimer's beta-amyloid precursor protein. Neuroreport. 1999 Aug 20;10(12):2575-8.  [Content Brief]

  [2]. Toshiro Hara, et al. Deletion of the Mint3/Apba3 gene in mice abrogates macrophage functions and increases resistance to lipopolysaccharide-induced septic shock. J Biol Chem  [Content Brief]