B4GALT1 Protein, Human (HEK293, Y285L, His)

B4GALT1 Protein, Human (HEK293 His) is responsible for the overcoming multidrug resistance in human leukemia therapy via regulating the activity of the hedgehog signaling pathway^[1][2].

B4GALT1 expression is identified as an independent adverse prognostic factor for survival in non-metastatic clear cell renal cell carcinoma modesl^[1]. B4GALT1 gene plays important roles in physiological process and disease development. B4GALT1 is shown to be responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids ^[2]. B4GALT1 is a new candidate to maintain the Stemness of lung Cancer stem cells^[3].

Measured by its ability to transfer N-Acetyl-D-galactosamine from UDP-GalNAc to N-Acetyl-D-glucosamine that incubate at 37℃ for 20 min. The specific activity is 415.10-526.68 pmol/min/μg.

Human

HEK293

C-6*His

P15291-1 (G44-S398, Y285L)

2683  [NCBI]

GRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPSHHHHHH

50-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 or 20mM Tris-HCl, 150mM NaCl, 2mM EDTA, 20% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Huyang Xie, et al. Increased B4GALT1 expression associates with adverse outcome in patients with non-metastatic clear cell renal cell carcinoma. Oncotarget. 2016 May 31;7(22):32723-30.  [Content Brief]

  [2]. Huimin Zhou, et al. B4GALT1 gene knockdown inhibits the hedgehog pathway and reverses multidrug resistance in the human leukemia K562/adriamycin-resistant cell line. IUBMB Life. 2012 Nov;64(11):889-900.  [Content Brief]

  [3]. Claudia De Vitis, et al. B4GALT1 Is a New Candidate to Maintain the Stemness of Lung Cancer Stem Cells. J Clin Med. 2019 Nov 9;8(11):1928.  [Content Brief]