1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. B4GALT1 Protein, Human (HEK293, Y285L, His)

B4GALT1 Protein, Human (HEK293 His) is responsible for the overcoming multidrug resistance in human leukemia therapy via regulating the activity of the hedgehog signaling pathway.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

B4GALT1 Protein, Human (HEK293 His) is responsible for the overcoming multidrug resistance in human leukemia therapy via regulating the activity of the hedgehog signaling pathway[1][2].

Background

B4GALT1 expression is identified as an independent adverse prognostic factor for survival in non-metastatic clear cell renal cell carcinoma modesl[1]. B4GALT1 gene plays important roles in physiological process and disease development. B4GALT1 is shown to be responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids [2]. B4GALT1 is a new candidate to maintain the Stemness of lung Cancer stem cells[3].

Biological Activity

Measured by its ability to transfer N-Acetyl-D-galactosamine from UDP-GalNAc to N-Acetyl-D-glucosamine that incubate at 37°C for 20 min. The specific activity is 415.10-526.68 pmol/min/μg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P15291-1 (G44-S398, Y285L)

Gene ID
Molecular Construction
N-term
B4GALT1 (G44-S398, Y285L)
Accession # P15291-1
6*His
C-term
Synonyms
rHuB4GALT1, His; B4GALT1; Beta-1,4-GalTase 1; CDG2D
AA Sequence

GRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPSHHHHHH

Molecular Weight

50-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 or 20mM Tris-HCl, 150mM NaCl, 2mM EDTA, 20% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

B4GALT1 Protein, Human (HEK293, Y285L, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B4GALT1 Protein, Human (HEK293, Y285L, His)
Cat. No.:
HY-P7628
Quantity:
MCE Japan Authorized Agent: